[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38557.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:369 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   15->246 2c99A PDBj 5e-05 17.1 %
:HMM:SCOP  9->169 1ny5A2 c.37.1.20 * 1.5e-09 22.2 %
:RPS:PFM   35->144 PF05673 * DUF815 1e-04 36.6 %
:HMM:PFM   34->72 PF05673 * DUF815 1.2e-07 43.2 37/250  
:BLT:SWISS 21->107 RFCL_THEAC 8e-04 27.6 %
:BLT:SWISS 300->349 ISPD_DESRM 3e-04 36.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38557.1 GT:GENE ABE38557.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1482635..1483744) GB:FROM 1482635 GB:TO 1483744 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38557.1 GB:DB_XREF GI:91682255 LENGTH 369 SQ:AASEQ MHGNPMNIPPVSIAAAKAALIEQYAEPTLRRRASMLWGTRGVGKSSVVRQVAEHYKVPLVDLRLTTIEPVDIRGAIYADENLAKTVWFPPEFLPSADQPEGLLFLDELTAADQRLQISAYSLILDRRVGNYQLPDGWLVVAAGNASFHGAISHDMGTALADRMFHFNVQTAIDAFLSHAMARDFAPEVMAYLKIRPDKLDDTQAQLAGDHLIGASPRGWEDISNVLKSGLSDQAKRLFVQGRIGAANAAEFFGVLREIKAGTDVVRLLAARPGPDTAALLPKTLDALYGMLYGLLAACTDQPTLARALEIIEQLPDIRGAVPLPIREAQTLAMELLMQRALENGLEAAIFDSPAYARYGERRQMDMQDA GT:EXON 1|1-369:0| BL:SWS:NREP 2 BL:SWS:REP 21->107|RFCL_THEAC|8e-04|27.6|76/100| BL:SWS:REP 300->349|ISPD_DESRM|3e-04|36.0|50/234| SEG 284->297|ldalygmlygllaa| RP:PDB:NREP 1 RP:PDB:REP 15->246|2c99A|5e-05|17.1|228/243| RP:PFM:NREP 1 RP:PFM:REP 35->144|PF05673|1e-04|36.6|93/248|DUF815| HM:PFM:NREP 1 HM:PFM:REP 34->72|PF05673|1.2e-07|43.2|37/250|DUF815| HM:SCP:REP 9->169|1ny5A2|1.5e-09|22.2|158/247|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 78 OP:NHOMOORG 74 OP:PATTERN --------------------1----------------------------------------------- ----2----------------1----------11-1-1-1---------------------1--1---2-----------11----------------------------------------------------------------------------------1------------------111---------------------------------------------11---------------------------------------------------------------------------------------------11-------1----------11-----1--1------------------1-----------------11111------------------1----------------------11-1111-----------------------------------------------------------1----------11---------1------------------------1-------------------1-1---1111--1-1-1----2------1----------------------1---1-----1-----------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------2111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 67.5 SQ:SECSTR ##############HHHHHHHHHHHHHTTccccEEEEccTTccHHHHHHHHHHTcTTTGcTccEEEEEGGGccHHHHHHHHHcccccccccHHHHTTTTTcEEEEEcGHHHHHHHHHHHHHcEEccccccccEEcccEEEEEEcccHHHHHHTcccHHHHHHHccEEEEcccGGGcHHHHHHHHHHHHHHHHHHTTccccccccHHHHHHHHHccTTHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHTTccccc########################################################################################################## DISOP:02AL 1-6,364-370| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHccccEEEEEcccccHHHHHccEEccccccHHHHccHHHHHccccccEEEEEEccccccHHHHHHHHHHHHccccccEEccccEEEEEEccccHHccccccccHHHHccEEEEEEcccHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccc //