[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38564.1
DDBJ      :             NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Swiss-Prot:NUOA_RHOPS   RecName: Full=NADH-quinone oxidoreductase subunit A;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit A;AltName: Full=NDH-1 subunit A;AltName: Full=NUO1;

Homologs  Archaea  10/68 : Bacteria  459/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   34->123 PF00507 * Oxidored_q4 1e-14 42.2 %
:HMM:PFM   24->123 PF00507 * Oxidored_q4 1.4e-26 36.0 100/102  
:BLT:SWISS 1->129 NUOA_RHOPS 2e-65 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38564.1 GT:GENE ABE38564.1 GT:PRODUCT NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1493690..1494079 GB:FROM 1493690 GB:TO 1494079 GB:DIRECTION + GB:PRODUCT NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 GB:PROTEIN_ID ABE38564.1 GB:DB_XREF GI:91682262 InterPro:IPR000440 LENGTH 129 SQ:AASEQ MGDLIFPINPGAALAIHVALSAGIVAAIIVVAAWLREKRSGARADVPYEGGVLPAAPQQGPVNAPYFLIAALFVIFDMEAAILFAWAVAARDTGWLGLIEAAVFIGVLLLALVYLWADGALDWHKERRR GT:EXON 1|1-129:0| SW:ID NUOA_RHOPS SW:DE RecName: Full=NADH-quinone oxidoreductase subunit A; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit A;AltName: Full=NDH-1 subunit A;AltName: Full=NUO1; SW:GN Name=nuoA; OrderedLocusNames=RPD_1326; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transmembrane; Transport; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->129|NUOA_RHOPS|2e-65|100.0|129/129| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 9->31| TM:REGION 65->87| TM:REGION 97->119| SEG 24->33|ivaaiivvaa| RP:PFM:NREP 1 RP:PFM:REP 34->123|PF00507|1e-14|42.2|90/108|Oxidored_q4| HM:PFM:NREP 1 HM:PFM:REP 24->123|PF00507|1.4e-26|36.0|100/102|Oxidored_q4| GO:PFM:NREP 2 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00507|IPR000440| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00507|IPR000440| OP:NHOMO 509 OP:NHOMOORG 470 OP:PATTERN ------------------------111-11-1-----------------1111--------------- 122-1----------1111-1---11111111----1--11111-1--------------1-1-111111------------21--------1------1-11--1-1-1---------------1-1111111211111----11-111--111111--1-1-1-1----1-11-----1-----------1-111111111111111------1-1111----------11----------------------------------------------------------------------------------------------1-----------------------1--1-1111----11-------11-1---11111111111112222211111111111-1111111111111111222111221311-11-2222111--------222--11-111111111-111111111111111111111111-11111111111111111111111111111111111111111--1111111111111211111111112111--------11-----222122213111111-2--111--------1-111---1-1111111---------------------1----11--2-1----11111111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111-111111111111--1----------------1111111--11-22221-1111111-111---------1--------------111111111111111---------------------------------------------------------1 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,41-41,125-130| PSIPRED cccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcc //