[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38591.1
DDBJ      :             protein of unknown function DUF140
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  576/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:378 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->95 1auzA PDBj 2e-06 10.2 %
:RPS:SCOP  7->95 1th8B  c.13.2.1 * 2e-07 13.6 %
:HMM:SCOP  2->98 1vc1A_ c.13.2.1 * 3.2e-07 20.8 %
:RPS:PFM   164->366 PF02405 * DUF140 5e-40 46.3 %
:HMM:PFM   161->373 PF02405 * DUF140 6.1e-74 43.2 213/215  
:HMM:PFM   46->95 PF01740 * STAS 3.2e-06 24.0 50/117  
:BLT:SWISS 164->364 Y1045_SYNY3 1e-28 29.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38591.1 GT:GENE ABE38591.1 GT:PRODUCT protein of unknown function DUF140 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1524114..1525250 GB:FROM 1524114 GB:TO 1525250 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF140 GB:PROTEIN_ID ABE38591.1 GB:DB_XREF GI:91682289 InterPro:IPR002114 InterPro:IPR003453 LENGTH 378 SQ:AASEQ MISAPVLTVVTDGDVLELHPGGAWIASQSAALERLFEGVAPQVAAAKSLKIDMTEVIEIDTIGAWLLEKASREAAQAGRTAHFVGVGERYAGLIEEVRQVNRHRPTPKPKVNPIIARLDQVGRSAWSATQDIAVFLDMFGALGVALLGVLRRPRSLRLTSLTYQIYRVGWRAIPIVVLITFLIGAIIAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEIDALSTMGLDPVEVLILPRIIALVIALPILTFIGSMSALYGGLLTAWFYGGMQPAVYIARLHEAVSLNSFEVGIWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVIVLDGLFAVFFASIGL GT:EXON 1|1-378:0| BL:SWS:NREP 1 BL:SWS:REP 164->364|Y1045_SYNY3|1e-28|29.4|201/263| TM:NTM 6 TM:REGION 129->150| TM:REGION 170->192| TM:REGION 205->227| TM:REGION 257->279| TM:REGION 318->339| TM:REGION 355->377| SEG 140->162|galgvallgvlrrprslrltslt| RP:PDB:NREP 1 RP:PDB:REP 7->95|1auzA|2e-06|10.2|88/116| RP:PFM:NREP 1 RP:PFM:REP 164->366|PF02405|5e-40|46.3|203/215|DUF140| HM:PFM:NREP 2 HM:PFM:REP 161->373|PF02405|6.1e-74|43.2|213/215|DUF140| HM:PFM:REP 46->95|PF01740|3.2e-06|24.0|50/117|STAS| RP:SCP:NREP 1 RP:SCP:REP 7->95|1th8B|2e-07|13.6|88/115|c.13.2.1| HM:SCP:REP 2->98|1vc1A_|3.2e-07|20.8|96/110|c.13.2.1|1/1|Anti-sigma factor antagonist SpoIIaa| OP:NHOMO 972 OP:NHOMOORG 594 OP:PATTERN -------------------------------------------------------------------- 111-----------57633-39--89333336B7A79759----------------------4-143222-------------221111111-1111--11211132222-------111----111111111131----------1122112111111111122111121111111111111-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2313221-----212222-22222211111111111-111111111121111111111111122212122222111222222222332322311111111111111111111111111111-112122222122222222222222322222222222222222221222222222222221212111111122323252321123233223213133352212124434111-1111111111111111121112211212-111121111123111111111111--11222------11111111111111111-1111111111111111111121111111111111111111111111111111-211111111111--1-1111122222-1111111111111111111111111---212222222222222211122222222211111111111212122222222222222---1221111----------------------------------------------121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------11117111111122-31--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 23.3 SQ:SECSTR ######ccEEEETTEEEEcccccccTTHHHHHHHHHHHHHcc#ccccEEEEEccccccccTTHHHHHHHHHHHHHHHTccccEEcccTTTTHHHH########################################################################################################################################################################################################################################################################################### DISOP:02AL 1-2,34-47,101-112| PSIPRED cccccEEEEEEEcccEEEEEccccHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHHHHHHHcccccEEccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //