[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38595.1
DDBJ      :             transcriptional regulator, Crp/Fnr family
Swiss-Prot:AADR_RHOPA   RecName: Full=Transcriptional activatory protein aadR;AltName: Full=Anaerobic aromatic degradation regulator;

Homologs  Archaea  0/68 : Bacteria  430/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:239 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   54->234 3dkwA PDBj 7e-11 26.6 %
:RPS:PDB   22->237 3e5xD PDBj 9e-31 14.4 %
:RPS:SCOP  22->155 2h6bA2  b.82.3.2 * 2e-17 12.7 %
:RPS:SCOP  160->239 2gauA1  a.4.5.4 * 1e-09 17.7 %
:HMM:SCOP  20->158 2gauA2 b.82.3.2 * 2.9e-25 28.8 %
:HMM:SCOP  159->240 2gauA1 a.4.5.4 * 9.6e-15 42.0 %
:RPS:PFM   48->96 PF00027 * cNMP_binding 2e-06 38.8 %
:RPS:PFM   188->218 PF00325 * Crp 1e-05 54.8 %
:HMM:PFM   187->218 PF00325 * Crp 7e-20 62.5 32/32  
:HMM:PFM   46->131 PF00027 * cNMP_binding 2.4e-15 26.7 86/91  
:BLT:SWISS 1->239 AADR_RHOPA e-126 91.6 %
:PROS 189->212|PS00042|HTH_CRP_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38595.1 GT:GENE ABE38595.1 GT:PRODUCT transcriptional regulator, Crp/Fnr family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1527675..1528394 GB:FROM 1527675 GB:TO 1528394 GB:DIRECTION + GB:PRODUCT transcriptional regulator, Crp/Fnr family GB:PROTEIN_ID ABE38595.1 GB:DB_XREF GI:91682293 InterPro:IPR000595 InterPro:IPR001808 InterPro:IPR012318 LENGTH 239 SQ:AASEQ MPHLAFPNSNCDGFRCATHCAVRPLAICGELEQAEHEEFERLAQHVRYGAKEALFSEDEVADAVYSLVEGIARLYKLLPDGRRQIIGFALPGDFLGMAPSARYSFSADAIGGVTVCKFFRGPFLRFIENKPHMLMRMNEFATRELSLAQDQMLLLGRRSAEEKVAAFLVGWRDRLARLEGVTKTVSLPMGRQDIADFLGLTIETVSRTFTKLEREKLIVIVPDGVRVLDPKRFDALAAA GT:EXON 1|1-239:0| SW:ID AADR_RHOPA SW:DE RecName: Full=Transcriptional activatory protein aadR;AltName: Full=Anaerobic aromatic degradation regulator; SW:GN Name=aadR; OrderedLocusNames=RPA4234; SW:KW Activator; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->239|AADR_RHOPA|e-126|91.6|239/239| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 189->212|PS00042|HTH_CRP_1|PDOC00041| BL:PDB:NREP 1 BL:PDB:REP 54->234|3dkwA|7e-11|26.6|177/227| RP:PDB:NREP 1 RP:PDB:REP 22->237|3e5xD|9e-31|14.4|216/220| RP:PFM:NREP 2 RP:PFM:REP 48->96|PF00027|2e-06|38.8|49/90|cNMP_binding| RP:PFM:REP 188->218|PF00325|1e-05|54.8|31/31|Crp| HM:PFM:NREP 2 HM:PFM:REP 187->218|PF00325|7e-20|62.5|32/32|Crp| HM:PFM:REP 46->131|PF00027|2.4e-15|26.7|86/91|cNMP_binding| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00325|IPR001808| GO:PFM GO:0005622|"GO:intracellular"|PF00325|IPR001808| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00325|IPR001808| RP:SCP:NREP 2 RP:SCP:REP 22->155|2h6bA2|2e-17|12.7|134/145|b.82.3.2| RP:SCP:REP 160->239|2gauA1|1e-09|17.7|79/81|a.4.5.4| HM:SCP:REP 20->158|2gauA2|2.9e-25|28.8|139/0|b.82.3.2|1/1|cAMP-binding domain-like| HM:SCP:REP 159->240|2gauA1|9.6e-15|42.0|81/0|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 754 OP:NHOMOORG 431 OP:PATTERN -------------------------------------------------------------------- -2------111------------------------------------1--------------1-1-----------------111111-------------31-1311-1----------------1---------2--11-----2--1--------------1------------------111-------------------------11------1-------------1--------------------11111121-1111111111121-11-------------------------------------------1-11-2111111111-1----333-11-1---1322-2--2--1----------3113------28784323344355545555536-5B886B77541-24456445225611---4215745211111111113111-333------------------------------1211-111114223233212233233333-324425542123212211133221211-111111111111111111-2-1-21---1--1-111111112------12-------------------------22111121212111211111111112111111----111------11111111111111111-1111111111111--11-1111111111111111111111111111111111-111111111111---1---------11111111111111111111----------1111111121131312211---------1111111111111112211111---------1-----------------2--------------------------1---------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 100.0 SQ:SECSTR EEccccccccccHHccccHHHccccccccccccGGGGGGGGGcEEEEEcTTcEEEcTTcccccEEEEEEcEEEEEEEcTTccEEEEEEEETTcEEccccccccEEEEEEcccEEEEEEcHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcEEETTEEEEEccccHHHHHHHHcccHHHHHHHHHHHHHTTcEEccccEEEEccHHHHHHHTHH DISOP:02AL 1-1| PSIPRED ccccccccccccccccccHHHHHcccccccccHHHHHHHHHHccEEEEccccEEEcccccccEEEEEEEcEEEEEEEcccccEEEEEEEccccEEEEccccccEEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEEcHHHHHHHHcc //