[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38599.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->84 PF09565 * RE_NgoFVII 0.00051 10.1 69/296  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38599.1 GT:GENE ABE38599.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1532445..1532732) GB:FROM 1532445 GB:TO 1532732 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38599.1 GB:DB_XREF GI:91682297 LENGTH 95 SQ:AASEQ MAKKAKAKTAKTAAKTKKAKTVAKTVAKTVAKPATKVAKKTKITRREYTKEDIKELRAHSKARTPVAQIAKLTKRTVGSLRQKALKLGIGLGHQR GT:EXON 1|1-95:0| SEG 2->42|akkakaktaktaaktkkaktvaktvaktvakpatkvakktk| HM:PFM:NREP 1 HM:PFM:REP 6->84|PF09565|0.00051|10.1|69/296|RE_NgoFVII| OP:NHOMO 11 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------113-111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19,93-96| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //