[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38600.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->53 PF07336 * DUF1470 0.0008 30.6 49/132  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38600.1 GT:GENE ABE38600.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1533279..1533521 GB:FROM 1533279 GB:TO 1533521 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE38600.1 GB:DB_XREF GI:91682298 LENGTH 80 SQ:AASEQ MAAFSAADWAARASPPAADIALLSGTADADSSLRGAAGGGVSVRFRDAGAVRRVSGFPERPAISLFGSFDEVIVIPDQHL GT:EXON 1|1-80:0| SEG 2->21|aafsaadwaarasppaadia| HM:PFM:NREP 1 HM:PFM:REP 3->53|PF07336|0.0008|30.6|49/132|DUF1470| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,6-7| PSIPRED cccccccHHHHccccccccEEEEEccccccccccccccccEEEEEEccccEEEEcccccccEEEEEccccEEEEcccccc //