[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38614.1
DDBJ      :             Sulfate ABC transporter, permease protein CysW
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  614/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   57->229 2onkC PDBj 1e-23 36.5 %
:RPS:SCOP  63->251 2r6gG1  f.58.1.1 * 5e-21 19.2 %
:RPS:PFM   78->251 PF00528 * BPD_transp_1 9e-05 33.3 %
:HMM:PFM   85->279 PF00528 * BPD_transp_1 5.2e-16 24.3 181/185  
:BLT:SWISS 23->251 CYSW_ECOLI 2e-76 55.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38614.1 GT:GENE ABE38614.1 GT:PRODUCT Sulfate ABC transporter, permease protein CysW GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1545814..1546677) GB:FROM 1545814 GB:TO 1546677 GB:DIRECTION - GB:PRODUCT Sulfate ABC transporter, permease protein CysW GB:PROTEIN_ID ABE38614.1 GB:DB_XREF GI:91682312 InterPro:IPR000515 InterPro:IPR005667 InterPro:IPR011866 LENGTH 287 SQ:AASEQ MSNPQPANKDWMVTPVGAGPVARFIVLSVVAVVTLFILIAPLAVILSSAFAQGVGVFLRNLGDPGTLHAMWLTTITALIAVPINILFGVAAAWTVTKFEFPGRTLLIALIELPYSISPIVAGVAYLFVYGSQGLFGPLLDQLDLKVMFALPGIVLASMFVTAPYVARELIPLMQVQGTDEEEAAVTLGAGGFATFFRVTLPNIRWAMLYGAILCNARVLGEFGAVSVVSGNVRGQTTTLPLQIELLYQDYNVAGAFAAATTLTAVAVVTILLKMLLERLAGDERPQP GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 23->251|CYSW_ECOLI|2e-76|55.5|229/291| TM:NTM 7 TM:REGION 13->35| TM:REGION 40->62| TM:REGION 71->93| TM:REGION 105->127| TM:REGION 149->171| TM:REGION 209->231| TM:REGION 255->277| SEG 252->269|vagafaaattltavavvt| BL:PDB:NREP 1 BL:PDB:REP 57->229|2onkC|1e-23|36.5|170/252| RP:PFM:NREP 1 RP:PFM:REP 78->251|PF00528|9e-05|33.3|162/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 85->279|PF00528|5.2e-16|24.3|181/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 63->251|2r6gG1|5e-21|19.2|182/284|f.58.1.1| OP:NHOMO 1983 OP:NHOMOORG 662 OP:PATTERN --111111-------1-------1123222321-11-25555312144-1532-2423312---1--- --1111112221-143333-33--343333333333334411112221311-2121-1--11212112211--------121311111----11-----------1-11----------------1212212321211121--15224333332255------33233331------------111---1-5-132323443333342354221133515241--------85111111111111111211112----------------------------------------------------------------------211322211211121333-12-3-21132341442-22-2-11--1--2---3333-----33586336455556666666566A-44433334224-588475663767C81---49576643222222222-33-2533--------------------------------1--455345557653344466654434247487454--554322334383457781233352333333222342-24242221-4221-43113435-31334212312111111-1-111111111231111432141-11--24444112444526215112---22-------33331343555355544-5434454333544233325656663345454555554555545555323432-47767777777722-2---------4141633332311111111233323234425533334334544443555----------2223555554325411333333332222--12222222--------1----------------------------22-------13- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222-----12---1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 60.3 SQ:SECSTR ########################################################HHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcTTcTTTTTGTTcccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHTTccHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHccHHHHTTc########################################################## DISOP:02AL 1-6,8-8,278-288| PSIPRED cccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //