[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38618.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->97 PF11011 * DUF2849 6e-05 34.5 %
:HMM:PFM   14->101 PF11011 * DUF2849 4.1e-30 44.3 88/90  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38618.1 GT:GENE ABE38618.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1550479..1550793 GB:FROM 1550479 GB:TO 1550793 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38618.1 GB:DB_XREF GI:91682316 LENGTH 104 SQ:AASEQ MTSPLQQKIKITGPSVVTANRTFDGVVIYRTGAQGWSTDLTEAAIVREAATARALLAESVADDVGAVGAYIAPVKIDDAGVVIPGNLREQIRKSGVTIALPAQA GT:EXON 1|1-104:0| SEG 41->61|teaaivreaatarallaesva| RP:PFM:NREP 1 RP:PFM:REP 14->97|PF11011|6e-05|34.5|84/90|DUF2849| HM:PFM:NREP 1 HM:PFM:REP 14->101|PF11011|4.1e-30|44.3|88/90|DUF2849| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,103-105| PSIPRED ccccHHHEEEEcccEEEEEccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHEEccEEccccccccccccccHHHHHHHHHccEEEccccc //