[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38622.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->67 PF10931 * DUF2735 3e-06 60.9 %
:HMM:PFM   22->68 PF10931 * DUF2735 3e-23 55.3 47/51  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38622.1 GT:GENE ABE38622.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1554227..1554445) GB:FROM 1554227 GB:TO 1554445 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38622.1 GB:DB_XREF GI:91682320 LENGTH 72 SQ:AASEQ MPSNECNEGEKETTVNPLNQTSAKIYQFPVGGRSGPSRREPNVADAGSHNVLTCASWYHEAALLEEQTRKPQ GT:EXON 1|1-72:0| RP:PFM:NREP 1 RP:PFM:REP 22->67|PF10931|3e-06|60.9|46/51|DUF2735| HM:PFM:NREP 1 HM:PFM:REP 22->68|PF10931|3e-23|55.3|47/51|DUF2735| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,67-73| PSIPRED cccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEHHHHHHHHHHHHHccccc //