[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38635.1
DDBJ      :             LSU ribosomal protein L36P
Swiss-Prot:RL36_RHOPS   RecName: Full=50S ribosomal protein L36;

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->41 2i2t41 g.42.1.1 * 3.7e-10 63.2 %
:HMM:PFM   1->41 PF00444 * Ribosomal_L36 7.1e-18 57.9 38/38  
:BLT:SWISS 1->41 RL36_RHOPS 4e-19 100.0 %
:PROS 14->40|PS00828|RIBOSOMAL_L36

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38635.1 GT:GENE ABE38635.1 GT:PRODUCT LSU ribosomal protein L36P GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1564550..1564675 GB:FROM 1564550 GB:TO 1564675 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L36P GB:PROTEIN_ID ABE38635.1 GB:DB_XREF GI:91682333 InterPro:IPR000473 LENGTH 41 SQ:AASEQ MKVRNSLKSLRSRHRDNRLVRRKGRIYVINKVQRRFKARQG GT:EXON 1|1-41:0| SW:ID RL36_RHOPS SW:DE RecName: Full=50S ribosomal protein L36; SW:GN Name=rpmJ; OrderedLocusNames=RPD_1398; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->41|RL36_RHOPS|4e-19|100.0|41/41| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 14->40|PS00828|RIBOSOMAL_L36|PDOC00650| HM:PFM:NREP 1 HM:PFM:REP 1->41|PF00444|7.1e-18|57.9|38/38|Ribosomal_L36| HM:SCP:REP 1->41|2i2t41|3.7e-10|63.2|38/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO 70 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--11111111-1111-11111111111-1111111111--11-1111-1111111-11111111-11-------------1---1-1-111----------------------1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13,37-42| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccc //