[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38640.1
DDBJ      :             protein of unknown function DUF1036
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   39->140 PF06282 * DUF1036 2e-31 59.8 %
:HMM:PFM   35->149 PF06282 * DUF1036 6.5e-48 55.7 115/115  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38640.1 GT:GENE ABE38640.1 GT:PRODUCT protein of unknown function DUF1036 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1568903..1569493) GB:FROM 1568903 GB:TO 1569493 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1036 GB:PROTEIN_ID ABE38640.1 GB:DB_XREF GI:91682338 InterPro:IPR009380 LENGTH 196 SQ:AASEQ MTSTDSLPRIAQPRRIQVALSAALALCAVVLAVAPAAADFRLCNNTSSRVGIALGYKDVDGWTTEGWWNVASRSCETLLRGTLVARYYYIYALDYDRGGEWSGQAFMCSRDKEFTIKGTENCLARGFDRTGFFEVDTGEQRAWTVQLTESNEQNTQKLPGLPGGSPPGAGMPGIPPTPGRTAPATPTAPPGDGNKP GT:EXON 1|1-196:0| TM:NTM 1 TM:REGION 18->40| SEG 18->38|valsaalalcavvlavapaaa| SEG 159->191|pglpggsppgagmpgipptpgrtapatptappg| RP:PFM:NREP 1 RP:PFM:REP 39->140|PF06282|2e-31|59.8|102/111|DUF1036| HM:PFM:NREP 1 HM:PFM:REP 35->149|PF06282|6.5e-48|55.7|115/115|DUF1036| OP:NHOMO 64 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111211111111111111-11111111121111111111111111-1---------21--------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,154-164,184-197| PSIPRED cccccccccccccEEEEEEEHHHHHHHHHHHHHccccccEEEccccccEEEEEEEEEcccccEEEEEEEEccccEEEEEccccccEEEEEEEEEccccEEccccEEEEEEccccccccccccccHHHHHcccEEEEEcccccEEEEEcccccccHHHccccccccccccccccccccccccccccccccccccccc //