[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38650.1
DDBJ      :             Death-on-curing protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  104/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.265.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->125 3dd7A PDBj 2e-09 29.5 %
:RPS:PDB   8->127 3dd7A PDBj 2e-14 28.6 %
:HMM:SCOP  37->95 2g03A1 a.265.1.1 * 1.6e-05 25.5 %
:HMM:PFM   9->89 PF02661 * Fic 4.6e-17 32.1 81/96  
:BLT:SWISS 13->125 DOC_BPP1 1e-09 30.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38650.1 GT:GENE ABE38650.1 GT:PRODUCT Death-on-curing protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1580265..1580657 GB:FROM 1580265 GB:TO 1580657 GB:DIRECTION + GB:PRODUCT Death-on-curing protein GB:PROTEIN_ID ABE38650.1 GB:DB_XREF GI:91682348 InterPro:IPR006440 LENGTH 130 SQ:AASEQ MNPPEEPIWLDIDEVIDMHAEQLSMFGGPEGLRDRGMLESALMRPVNQWHYGEVDMAALAAAYAFGLARNHPFVDGNKRIAFLSMVAFLRMNDISFAPDPGQATSIILSLAAGEVSEASLTRWIRDNWPA GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 13->125|DOC_BPP1|1e-09|30.4|112/100| SEG 57->68|aalaaayafgla| BL:PDB:NREP 1 BL:PDB:REP 13->125|3dd7A|2e-09|29.5|112/123| RP:PDB:NREP 1 RP:PDB:REP 8->127|3dd7A|2e-14|28.6|119/123| HM:PFM:NREP 1 HM:PFM:REP 9->89|PF02661|4.6e-17|32.1|81/96|Fic| HM:SCP:REP 37->95|2g03A1|1.6e-05|25.5|55/0|a.265.1.1|1/1|Fic-like| OP:NHOMO 109 OP:NHOMOORG 104 OP:PATTERN -------------------------------------------------------------------- --1-1---------------------------------------------------------------------------1---------------------------1---------------111-111--1-1-111-------11-122----------1--1-11----------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1---1-------1-11---------1---1111--------11--1-111111111111111-11-1111-1-1-1----1-11----1-1--1--2-----11111111-121---1---------------------------------------------------------------------1---1-----1-111--1-------------21-------------1--------------111------------------------------------------------------------------------------1------------------------------------------1----------------------1-----------------------------------------------------------------------------------------------------1-1--111--------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 93.1 SQ:SECSTR #######ccccHHHHHHHHHHHHHHHccccccccTTHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHTTccccccTTHHHHHHHHHHTTcccHHHHHHHHHHHH## DISOP:02AL 1-1,130-131| PSIPRED cccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEccHHHHHHHHHHHHcccccHHHHHHHHHHHccc //