[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38653.1
DDBJ      :             nicotinamide nucleotide transhydrogenase, subunit alpha2
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  355/915 : Eukaryota  58/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->61 PF11872 * DUF3392 8.5e-07 22.6 53/106  
:BLT:SWISS 6->107 PNTAB_RHORU 2e-22 51.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38653.1 GT:GENE ABE38653.1 GT:PRODUCT nicotinamide nucleotide transhydrogenase, subunit alpha2 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1582363..1582686 GB:FROM 1582363 GB:TO 1582686 GB:DIRECTION + GB:PRODUCT nicotinamide nucleotide transhydrogenase, subunit alpha2 GB:PROTEIN_ID ABE38653.1 GB:DB_XREF GI:91682351 LENGTH 107 SQ:AASEQ MEHVVQAVDPFVFRLSIFVLAVFVGYFVVWAVTPALHTPLMSVTNAISSVIVVGALLAVGVSLVGSDNGPLWARGFGFVALIFASVNIFGGFLVTQRMLAMYKKKQK GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 6->107|PNTAB_RHORU|2e-22|51.0|96/139| TM:NTM 3 TM:REGION 10->32| TM:REGION 43->65| TM:REGION 75->97| SEG 48->66|ssvivvgallavgvslvgs| HM:PFM:NREP 1 HM:PFM:REP 9->61|PF11872|8.5e-07|22.6|53/106|DUF3392| OP:NHOMO 453 OP:NHOMOORG 413 OP:PATTERN -------------------------------------------------------------------- --1-1--------111111-11--131-1111-1111-21----------------------1-1111----------------------------------------1-------------------------------------1-1---------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----111111111111111111111111-11111111111-1--11132111111111-1--1---11111111111----111------------11111111-1111----11111-111-211111111111112111111121128411111211-11111121--1----111111-11111-----1-----------------------1--------------------------------1111111----111111--111111-11-----1---------111111-1111111111-11111111111111111111111111-1111111111111111111111111-111111111111----11111111111-1-111111111111---111111111111111-11111-1111-11----------11111111111111----------------1-111111----------------------------------------------1-- -1--11--1------------------------------------------------11----------------------------------------1-------11-214221111---1--1---262-12111111-121-11-11-1111121-12111---11-11----------1---1-----1----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,104-108| PSIPRED ccHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //