[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38671.1
DDBJ      :             3-oxoacid CoA-transferase, subunit A
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  406/915 : Eukaryota  151/199 : Viruses  0/175   --->[See Alignment]
c.124.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->230 3cdkC PDBj 2e-75 59.4 %
:RPS:PDB   1->230 3cdkC PDBj 2e-66 63.8 %
:RPS:SCOP  1->217 1k6dA  c.124.1.2 * 2e-49 44.4 %
:HMM:SCOP  1->234 1m3eA1 c.124.1.2 * 1.9e-84 54.7 %
:RPS:PFM   26->216 PF01144 * CoA_trans 5e-35 46.6 %
:HMM:PFM   7->215 PF01144 * CoA_trans 9.7e-82 52.7 207/218  
:BLT:SWISS 25->231 SCOA_XANCB 7e-81 69.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38671.1 GT:GENE ABE38671.1 GT:PRODUCT 3-oxoacid CoA-transferase, subunit A GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1600263..1600979 GB:FROM 1600263 GB:TO 1600979 GB:DIRECTION + GB:PRODUCT 3-oxoacid CoA-transferase, subunit A GB:PROTEIN_ID ABE38671.1 GB:DB_XREF GI:91682369 InterPro:IPR004165 InterPro:IPR012792 LENGTH 238 SQ:AASEQ MNKVYPDAETALAGILRDGMMIMSGGFGLCGIAETLSDALRESGVKDLTVVSNNAGVDGIGLSRLLETRQIKKMISSYVGENKLFAQQFLAGELELEFAPQGTLAERIRAGGAGIPAFFTKTGVGTLVAEGKEVREFDGEKYVMERGLFADLAIVHAWKGDTAGNLVYRKTARNFNPMMATAAKITIAEVEHLVPAGEIDPDHIHTPGIFVQRIIDVGTGKKRIEQRTTRKRPEAAAT GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 25->231|SCOA_XANCB|7e-81|69.1|207/242| BL:PDB:NREP 1 BL:PDB:REP 1->230|3cdkC|2e-75|59.4|229/229| RP:PDB:NREP 1 RP:PDB:REP 1->230|3cdkC|2e-66|63.8|229/229| RP:PFM:NREP 1 RP:PFM:REP 26->216|PF01144|5e-35|46.6|189/213|CoA_trans| HM:PFM:NREP 1 HM:PFM:REP 7->215|PF01144|9.7e-82|52.7|207/218|CoA_trans| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01144|IPR004165| GO:PFM GO:0008410|"GO:CoA-transferase activity"|PF01144|IPR004165| RP:SCP:NREP 1 RP:SCP:REP 1->217|1k6dA|2e-49|44.4|214/217|c.124.1.2| HM:SCP:REP 1->234|1m3eA1|1.9e-84|54.7|232/250|c.124.1.2|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 899 OP:NHOMOORG 559 OP:PATTERN ---------------------1------------------------------------------1--- 11--4--31111---1111-12--111111113223-433-211-1-1----343211----4--2-111------------------------11---1-11111---1-----------------------------------1-------------------------------------322-----1-2111111111111111121112111---111-1111113--------------------1-----------------------------1111--------------2222222222222---------1-12151111111212-1--1----1------------4--3-1--1--3----2221-----223112111511111-211111-1-22222323-1--111311-2111113111212111121111111111211---12------------12111211--11------1381-2442722222222222223322222222333331333231222222223111----------------1-21------------------1-1--11111111-----------1-1111111----------1--2-12-2111111222211111121-------------1-1-1--1--2121221--11122212--212212222221111-----------------2------1-----------------1-----------1-2-------11-1--1-44534241212-11111111222321111------------------------1111111111--------------------------------------------------11111-1------ ----111-531-----23433322333111111111111111111112222434231222221-1----1----1------11111---13221111111111----11122212411222121311212B2-115112111152111111211141121311411121121121--1----------13--212221- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 98.3 SQ:SECSTR cccccccHHHHHTTcccTTcEEEEcccTTcTccHHHHHHHHHHTcccEEEEccccccTTcTTHHHHHTTcEEEEEEccccccHHHHHHHHHTccEEEEccHHHHHHHHHHHHHTccEEEEcTTTTcGGGTTccEEEETTEEEEEEEcccEEEEEEEEEEEETTccEEccGGGcTTHHHHHHHEEEEEEEEEEEEcTTcccTTTccccGGGccEEEEccccccccccccccccTc#### DISOP:02AL 1-1,225-239| PSIPRED cccccccHHHHHHHHcccccEEEEccccccccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHcccccEEEEccccccHHHHHHHHcccEEEEEccHHHHHHHHHHHHccccEEEEEEEEcccccccccEEEEcccEEEEEccccccEEEEEEEEEcccccEEEEccccccHHHHHHHccEEEEEEEEEEccccccHHHEEEccEEEEEEEEcccccccEEEEEEccccccccc //