[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38693.1
DDBJ      :             transcription elongation factor GreA
Swiss-Prot:GREA_RHOPT   RecName: Full=Transcription elongation factor greA;AltName: Full=Transcript cleavage factor greA;

Homologs  Archaea  0/68 : Bacteria  845/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.2.1d.26.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->139 1grjA PDBj 2e-27 43.8 %
:RPS:PDB   34->164 3bmbA PDBj 4e-35 23.6 %
:RPS:SCOP  10->87 1grjA1  a.2.1.1 * 9e-25 55.1 %
:RPS:SCOP  89->163 2etnA2  d.26.1.2 * 4e-20 30.7 %
:HMM:SCOP  10->87 1grjA1 a.2.1.1 * 6.5e-28 57.7 %
:HMM:SCOP  87->165 1grjA2 d.26.1.2 * 5.9e-22 48.1 %
:RPS:PFM   14->82 PF03449 * GreA_GreB_N 4e-16 66.7 %
:RPS:PFM   89->163 PF01272 * GreA_GreB 2e-13 57.3 %
:HMM:PFM   8->82 PF03449 * GreA_GreB_N 6.2e-34 62.2 74/74  
:HMM:PFM   89->163 PF01272 * GreA_GreB 5.2e-28 52.0 75/77  
:BLT:SWISS 8->165 GREA_RHOPT 1e-82 94.3 %
:PROS 25->56|PS00829|GREAB_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38693.1 GT:GENE ABE38693.1 GT:PRODUCT transcription elongation factor GreA GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1625785..1626282) GB:FROM 1625785 GB:TO 1626282 GB:DIRECTION - GB:PRODUCT transcription elongation factor GreA GB:PROTEIN_ID ABE38693.1 GB:DB_XREF GI:91682391 InterPro:IPR001437 InterPro:IPR006359 LENGTH 165 SQ:AASEQ MLKDEGKMVEKVPMTAGGYAALSDELKHRQSVDRPRIIEHIAEARSHGDLSENAEYHAAKEEQSHNEGRIAELEDKLARADIIDISKLSGDTIKFGATVTLIDEDTEKKAVWQIVGESEADAKKGKISITSPLARALIGKTQGTSVEVVAPGGAKAYEIAKVEWR GT:EXON 1|1-165:0| SW:ID GREA_RHOPT SW:DE RecName: Full=Transcription elongation factor greA;AltName: Full=Transcript cleavage factor greA; SW:GN Name=greA; OrderedLocusNames=Rpal_4606; SW:KW Coiled coil; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 8->165|GREA_RHOPT|1e-82|94.3|158/158| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 25->56|PS00829|GREAB_1|PDOC00651| BL:PDB:NREP 1 BL:PDB:REP 10->139|1grjA|2e-27|43.8|130/151| RP:PDB:NREP 1 RP:PDB:REP 34->164|3bmbA|4e-35|23.6|123/135| RP:PFM:NREP 2 RP:PFM:REP 14->82|PF03449|4e-16|66.7|69/73|GreA_GreB_N| RP:PFM:REP 89->163|PF01272|2e-13|57.3|75/78|GreA_GreB| HM:PFM:NREP 2 HM:PFM:REP 8->82|PF03449|6.2e-34|62.2|74/74|GreA_GreB_N| HM:PFM:REP 89->163|PF01272|5.2e-28|52.0|75/77|GreA_GreB| GO:PFM:NREP 6 GO:PFM GO:0003677|"GO:DNA binding"|PF03449|IPR001437| GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF03449|IPR001437| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03449|IPR001437| GO:PFM GO:0003677|"GO:DNA binding"|PF01272|IPR001437| GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF01272|IPR001437| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01272|IPR001437| RP:SCP:NREP 2 RP:SCP:REP 10->87|1grjA1|9e-25|55.1|78/78|a.2.1.1| RP:SCP:REP 89->163|2etnA2|4e-20|30.7|75/79|d.26.1.2| HM:SCP:REP 10->87|1grjA1|6.5e-28|57.7|78/0|a.2.1.1|1/1|GreA transcript cleavage protein, N-terminal domain| HM:SCP:REP 87->165|1grjA2|5.9e-22|48.1|79/79|d.26.1.2|1/1|FKBP-like| OP:NHOMO 1227 OP:NHOMOORG 847 OP:PATTERN -------------------------------------------------------------------- 12211------11111111-11111111111111111111111-1-111-1-111111111111111-111111111111111-----111111111-12121221111111111111------1111111111111111111112-------------------------------------33211--1111111111111111111111111111111111211111112111111111111111111111222222222222222212211111111111111111111111111111111111111111111111111111122222111212112212222211122211221111111111111--111111111111121111111111111111111111122122122121111121121111111111111111111111111111122222211111111111111111111111111111112222222222333333233333322333322332222222322222222222213222433222222222222222211111111111111323323213333232121111111111111111111121111112222222222122222222223222223221-1111111111122222222222222222-222222222222222222222222222222222222222222222222222212222222122221112111111111222222222222222222222222212111222222233222222233211111111122222222222222222222222221111111111111111111111111111-1-1111111111111111111111111111112- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 93.9 SQ:SECSTR #########ccEEHccHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHcGGGTTcHHHHHHccccccHHHHHHHTcEEEcGGGccTTcccTTcEEEEEETTTccEEEEEEEcGGGcccTTTEEETTcHHHHHHTTccTTcEEEEEETTTEEEEEEEEEEE# DISOP:02AL 1-5| PSIPRED ccccccEEEEEEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcEEEcHHHccccEEEEEEEEEEEEcccccEEEEEEEcHHHcccccccEEEccHHHHHHcccccccEEEEEcccccEEEEEEEEEEc //