[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38697.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:54 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->54 PF11752 * DUF3309 1.7e-16 47.9 48/49  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38697.1 GT:GENE ABE38697.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1631588..1631752 GB:FROM 1631588 GB:TO 1631752 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38697.1 GB:DB_XREF GI:91682395 LENGTH 54 SQ:AASEQ MSIATVLIIVLIILLLGGLSQRFGGYGYGQGHGMTGLIGVVLTVLLVLVVLGKI GT:EXON 1|1-54:0| TM:NTM 2 TM:REGION 1->23| TM:REGION 32->54| SEG 6->19|vliivliilllggl| SEG 24->52|ggygygqghgmtgligvvltvllvlvvlg| HM:PFM:NREP 1 HM:PFM:REP 5->54|PF11752|1.7e-16|47.9|48/49|DUF3309| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcc //