[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38703.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->75 2js3A PDBj 5e-29 73.3 %
:RPS:PFM   1->75 PF11519 * DUF3222 2e-28 81.3 %
:HMM:PFM   1->75 PF11519 * DUF3222 4.5e-50 85.1 74/74  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38703.1 GT:GENE ABE38703.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1635803..1636030) GB:FROM 1635803 GB:TO 1636030 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38703.1 GB:DB_XREF GI:91682401 LENGTH 75 SQ:AASEQ MTDAAAEEIRKIAAALVKTAIEIVSEEDGGAHNQCKLCNASVPWLQTGDEIKHAPDCPVVIAQRILSSKPRLHSV GT:EXON 1|1-75:0| SEG 4->15|aaaeeirkiaaa| BL:PDB:NREP 1 BL:PDB:REP 1->75|2js3A|5e-29|73.3|75/96| RP:PFM:NREP 1 RP:PFM:REP 1->75|PF11519|2e-28|81.3|75/75|DUF3222| HM:PFM:NREP 1 HM:PFM:REP 1->75|PF11519|4.5e-50|85.1|74/74|DUF3222| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 100.0 SQ:SECSTR TTTHHHHHHHHHHHHHHHTcEEEEEcccccEEEEETTcccEEETTcccccccccTTcTHHHHHHHHHcccccccc DISOP:02AL 1-7,71-71,73-76| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEccccccccccccHHccccccHHHHHHHHHHcccccccc //