[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38707.1
DDBJ      :             protein of unknown function DUF214
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  369/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:404 amino acids
:PSIPRED
:RPS:PFM   278->321 PF02687 * FtsX 2e-04 43.2 %
:HMM:PFM   228->398 PF02687 * FtsX 4.6e-29 27.6 170/175  
:BLT:SWISS 123->322 LOLC_XYLFT 1e-12 25.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38707.1 GT:GENE ABE38707.1 GT:PRODUCT protein of unknown function DUF214 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1638930..1640144 GB:FROM 1638930 GB:TO 1640144 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF214 GB:PROTEIN_ID ABE38707.1 GB:DB_XREF GI:91682405 InterPro:IPR003838 LENGTH 404 SQ:AASEQ MPFEWIAAVRFLLDGALQTLVIVGGIAIGVGVIVFMSAMLAGLQANFIKRVLTSQPQIQLIPPDQVARPLRDEPGTVEVATVQRPTQRVISIDQWPKIRAEMQARPDVVYAAATASGSALALRGDTSRAITLYGIEPEIYFQIVKVPDFIVAGEAQITTEGILIGVELARDLGASLGDKIIVSTPLAGNRVLTIKGIFDFGNKAANQRNTFVTLRNAQSMLGLIGGVTSIDITVADIYTAETIAQEIQATLPVKADSWIRTNAQFFTAVKAQQNSNTLIRLFVGLSVAFGIAAVLIVSVIQRSKDIGILRAMGARREQILRVFLIQGGLLGFIGALIGSGLGALALFAWHQSARQVDGSELFPLILESELFIASSLLATLTGVAAAIAPALRAARLDPVVAIRG GT:EXON 1|1-404:0| BL:SWS:NREP 1 BL:SWS:REP 123->322|LOLC_XYLFT|1e-12|25.1|199/413| TM:NTM 5 TM:REGION 14->36| TM:REGION 217->239| TM:REGION 278->300| TM:REGION 324->346| TM:REGION 369->391| SEG 21->34|vivggiaigvgviv| SEG 111->122|aaatasgsalal| SEG 323->348|fliqggllgfigaligsglgalalfa| SEG 384->396|aaaiapalraarl| RP:PFM:NREP 1 RP:PFM:REP 278->321|PF02687|2e-04|43.2|44/177|FtsX| HM:PFM:NREP 1 HM:PFM:REP 228->398|PF02687|4.6e-29|27.6|170/175|FtsX| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02687|IPR003838| OP:NHOMO 422 OP:NHOMOORG 373 OP:PATTERN ------------------------------------------------2-422--------------- 111--------------------------------------------------------------------------------1-122--------------1-1--------------------221-12-1221------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1---------------1-------------------1--------1-11-222-11111--112---1111111111111111-111111111-1-11111111112211---111-11111-11111111111--112111-1111----11--111111111111111111-1111112222111111111111111121111111-111111111211111121111111-11111111111-111111111111111111111212211-111-------------------------111121123---111111211111111111-1--11111--------11---------------------------------1-11111-1-1-1111111111-1----------111111111111---111111222211111---------------111-111-1-22111112112111131111111111111---411111111----11111---1111111111--11----------------------------------------------12- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccEEEccccccccccccHHHHHHHHHHccccEEEEEEccccEEEEEccEEEEEEEEEEcHHHHHHHHHHHHHHHcccccccccEEEEEHHHHHHcccccccEEEEEEccccEEEEEEEEEEEccccHHccEEEEEEHHHHHHHccccccEEEEEEEEccHHHHHHHHHHHHHHccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEcccHHHHHHHHHHccHHHHHHHHHHHccccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcc //