[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38720.1
DDBJ      :             Glyoxalase/bleomycin resistance protein/dioxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   85->134 1mpyA PDBj 2e-05 44.0 %
:RPS:PDB   5->135 3e5dA PDBj 6e-16 16.7 %
:RPS:SCOP  1->136 1zswA1  d.32.1.10 * 3e-17 22.3 %
:HMM:SCOP  1->136 1zswA2 d.32.1.10 * 1.1e-33 38.0 %
:RPS:PFM   5->133 PF00903 * Glyoxalase 1e-10 37.7 %
:HMM:PFM   6->134 PF00903 * Glyoxalase 3.5e-20 26.7 120/128  
:BLT:SWISS 44->163 FOSB_BACSK 7e-06 35.6 %
:PROS 114->133|PS00082|EXTRADIOL_DIOXYGENAS

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38720.1 GT:GENE ABE38720.1 GT:PRODUCT Glyoxalase/bleomycin resistance protein/dioxygenase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1651286..1651828) GB:FROM 1651286 GB:TO 1651828 GB:DIRECTION - GB:PRODUCT Glyoxalase/bleomycin resistance protein/dioxygenase GB:PROTEIN_ID ABE38720.1 GB:DB_XREF GI:91682418 InterPro:IPR000486 InterPro:IPR004360 InterPro:IPR011588 LENGTH 180 SQ:AASEQ MQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGNILAFFELPNSPPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFKSIYFWDPSGHRLEVAAWTATPQQLAQMKDVAHAMVDEWAETKKPPRHTAWLHQKEFADAK GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 44->163|FOSB_BACSK|7e-06|35.6|118/146| PROS 114->133|PS00082|EXTRADIOL_DIOXYGENAS|PDOC00078| BL:PDB:NREP 1 BL:PDB:REP 85->134|1mpyA|2e-05|44.0|50/307| RP:PDB:NREP 1 RP:PDB:REP 5->135|3e5dA|6e-16|16.7|120/122| RP:PFM:NREP 1 RP:PFM:REP 5->133|PF00903|1e-10|37.7|114/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 6->134|PF00903|3.5e-20|26.7|120/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->136|1zswA1|3e-17|22.3|130/144|d.32.1.10| HM:SCP:REP 1->136|1zswA2|1.1e-33|38.0|121/0|d.32.1.10|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 90 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- -----------------11-11--111111111---1111-1----------------------1-------------------------------------------------------------------------------1----------11-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111--------111---1-11----------------------1---------------1121---------2----------------------------------------------1111---------1-----------------2-111-1----12-111212-13--1----------------11--------------------------------1---------------------------------1-1-------------------11--------------------------------------------------------------------------1------------------------1-----------------------------111111--111---------------------------------------------1-11------------------------------------------------------------------ ------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 97.8 SQ:SECSTR cccEcccEEEEEcccHHHHHHHHTHHHccEEcccEEEGTTTEEGGGGTEEEEEEEcccccEEEEEETTccccccccccccccEEEEcccHHHHHHHHHHHHHHHHTTccEEEEEcTTccEEEEEEcTTccEEEEEccccccccHHHHHEEEcTTccccccTTcEEEEHHHHHHHTc#### DISOP:02AL 1-1,178-181| PSIPRED ccEEEEEEEEEEcccHHHHHHHHHHHHccEEEEEEcccccccccccccEEEEEEEcccccEEEEEEccccccccccccccccEEEEEEEEccHHHHHHHHHHHHHcccEEEcccccccEEEEEEEcccccEEEEEEccccccccccccccccccccHHHcccccccccccccHHHHcccc //