[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38725.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   39->62 PF08266 * Cadherin_2 0.00056 37.5 24/84  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38725.1 GT:GENE ABE38725.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1656450..1656881) GB:FROM 1656450 GB:TO 1656881 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38725.1 GB:DB_XREF GI:91682423 LENGTH 143 SQ:AASEQ MSASGNPSISNAPVTDVVAAVVREWEEITASPGELEAFGRAMANMVKDLGLSPSEVRALATKGSSAKELPCLLDALGISIRALAEKDPMLLNDLRRTCAMCEHKRECNDDIVAGTLLQSYQRYCLNVDSLRALQHDANFAAES GT:EXON 1|1-143:0| HM:PFM:NREP 1 HM:PFM:REP 39->62|PF08266|0.00056|37.5|24/84|Cadherin_2| OP:NHOMO 13 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---22222------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,141-144| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHccc //