[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38747.1
DDBJ      :             phenylglyoxylate:acceptor oxidoreductase PadE subunit
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.64.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->180 2raaA PDBj 9e-15 35.9 %
:RPS:PDB   27->101 2ec5A PDBj 2e-07 17.6 %
:RPS:SCOP  2->183 1b0pA4  c.64.1.1 * 6e-10 22.0 %
:HMM:SCOP  1->180 1b0pA4 c.64.1.1 * 6.5e-40 36.7 %
:RPS:PFM   10->176 PF01558 * POR 1e-15 35.2 %
:HMM:PFM   10->176 PF01558 * POR 3.1e-34 31.3 163/173  
:BLT:SWISS 1->181 PORC_PYRHO 3e-35 43.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38747.1 GT:GENE ABE38747.1 GT:PRODUCT phenylglyoxylate:acceptor oxidoreductase PadE subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1685383..1685955 GB:FROM 1685383 GB:TO 1685955 GB:DIRECTION + GB:PRODUCT phenylglyoxylate:acceptor oxidoreductase PadE subunit GB:PROTEIN_ID ABE38747.1 GB:DB_XREF GI:91682445 InterPro:IPR002869 InterPro:IPR011894 LENGTH 190 SQ:AASEQ MYEVRLHGRGGQGAVMAAGILAAGLVAEGRFAVAIPSFGFERRGAPVVAFLRSDEREIRRMTNITYPDCVVCIDPTVARSVDIFAGLKPGGTLVQTTSKPLGELSLSDAVGTVGLIDAIRIAMEIFRRPITNTLMLGAFARTTGVVSLDALKQALADSDFRDAGLGQNLAALDRGYHETEVHRLGCEAAA GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 1->181|PORC_PYRHO|3e-35|43.3|180/185| BL:PDB:NREP 1 BL:PDB:REP 2->180|2raaA|9e-15|35.9|167/174| RP:PDB:NREP 1 RP:PDB:REP 27->101|2ec5A|2e-07|17.6|68/711| RP:PFM:NREP 1 RP:PFM:REP 10->176|PF01558|1e-15|35.2|165/178|POR| HM:PFM:NREP 1 HM:PFM:REP 10->176|PF01558|3.1e-34|31.3|163/173|POR| GO:PFM:NREP 2 GO:PFM GO:0016903|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors"|PF01558|IPR019752| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01558|IPR019752| RP:SCP:NREP 1 RP:SCP:REP 2->183|1b0pA4|6e-10|22.0|182/253|c.64.1.1| HM:SCP:REP 1->180|1b0pA4|6.5e-40|36.7|180/253|c.64.1.1|1/1|Pyruvate-ferredoxin oxidoreductase, PFOR, domain III| OP:NHOMO 173 OP:NHOMOORG 127 OP:PATTERN --2121212222222122233332-----1--11112211111322221111111111111-112--- -1--------------------------------------1-1-------------------1----------------11--11111-----------------------------------------------------111--------------------------------------------11------------------------------1------------------------------------------------------------------------------------------------------2----------------111----12-11--11---1-21--3---21---1--------------------1------------------------------------------------------------------1---------------------------------------------------------------------------1-------1----1----------------1-----11--------------11-12------24-----------111111111-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1111111121--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 93.7 SQ:SECSTR #EEEEEEEETTccHHHHHHHHHHHHHEEEEEEccccEEEEccTTcEETTGGGccccccccccEEEEHHHHHHHHHHHTTcEEEEcccccHHHHHTcccccGHHHHHHHcccEEEEEcHHHHHHHHTcccccHHHHHHHHHHHHccccHHHHHHHH#HHcccHHHHHHHHHHHHHHHHHcE########## DISOP:02AL 188-191| PSIPRED cEEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEcccHHHccccEEEEEEEcccEEEcccccccccEEEEEcHHHHHHHHHHHccccccEEEEcccccHHHHHHHcccccEEEEcHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcEEEccccccc //