[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38751.1
DDBJ      :             phenylglyoxylate:acceptor oxidoreductase PadI subunit
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  323/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.36.1d.58.1
:442 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->117 1kqfB PDBj 5e-11 31.8 %
:BLT:PDB   238->414 1kekA PDBj 9e-15 32.2 %
:RPS:PDB   7->71 1dwlA PDBj 8e-05 25.0 %
:RPS:PDB   54->117 1bc6A PDBj 7e-09 27.4 %
:RPS:PDB   218->431 3dvaA PDBj 5e-12 16.8 %
:RPS:SCOP  8->117 1ti2B2  d.58.1.5 * 2e-18 25.0 %
:RPS:SCOP  166->382 1b0pA2  c.36.1.12 * 2e-13 22.1 %
:HMM:SCOP  8->183 1q16B_ d.58.1.5 * 3.5e-35 33.0 %
:HMM:SCOP  140->436 1b0pA2 c.36.1.12 * 2.8e-59 31.4 %
:RPS:PFM   193->283 PF00676 * E1_dh 7e-08 36.2 %
:HMM:PFM   206->349 PF02775 * TPP_enzyme_C 6.2e-21 28.6 126/150  
:HMM:PFM   9->25 PF00037 * Fer4 2.8e-05 41.2 17/24  
:BLT:SWISS 8->118 YGFT_ECOLI 8e-14 34.6 %
:BLT:SWISS 148->426 PORB_METTH 2e-59 43.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38751.1 GT:GENE ABE38751.1 GT:PRODUCT phenylglyoxylate:acceptor oxidoreductase PadI subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1688756..1690084 GB:FROM 1688756 GB:TO 1690084 GB:DIRECTION + GB:PRODUCT phenylglyoxylate:acceptor oxidoreductase PadI subunit GB:PROTEIN_ID ABE38751.1 GB:DB_XREF GI:91682449 InterPro:IPR001450 InterPro:IPR011766 LENGTH 442 SQ:AASEQ MGQAYTTIAFDAAKCDGCRQCMSACATAKNGADDSARARLQVLPTDGGFELAMCRQCGDPKCVTVCPAGALAKDGDTGVIGWDAGKCVDCLLCTVGCAYAGIARDETDGRVAKCDMCDGAPACVAACPTAALSHITTARIYNEVGDWEDLFTPGLAGCQGCNTELLMRHALRRVGPDTVLATPPGCVPGMGSVGYNGLTGTKVPVFHPLLTNTAPMLAGVKRQLKRKGREVTAMAIAGDGGASDVGFQSLSGAAERGEEILFMVVDNEGYMNTGMQRSSCTPYGAWTSTTPVGRESKGKTQDAKNLPLLMVNHRCAYVATASTAFMQDLYDKLDKAIAASKQGFAYLHVYSPCTTGWRFPTDQNMEVARKAVETNFVMLWEFTPSNGLHFTHPVDAPLPITDYLKAMGRFRHLDADQIRHIQAKVDENRAIIEQLATGVRAA GT:EXON 1|1-442:0| BL:SWS:NREP 2 BL:SWS:REP 8->118|YGFT_ECOLI|8e-14|34.6|107/639| BL:SWS:REP 148->426|PORB_METTH|2e-59|43.8|274/288| SEG 120->131|apacvaacptaa| BL:PDB:NREP 2 BL:PDB:REP 11->117|1kqfB|5e-11|31.8|107/289| BL:PDB:REP 238->414|1kekA|9e-15|32.2|171/1231| RP:PDB:NREP 3 RP:PDB:REP 7->71|1dwlA|8e-05|25.0|56/59| RP:PDB:REP 54->117|1bc6A|7e-09|27.4|62/77| RP:PDB:REP 218->431|3dvaA|5e-12|16.8|173/365| RP:PFM:NREP 1 RP:PFM:REP 193->283|PF00676|7e-08|36.2|80/298|E1_dh| HM:PFM:NREP 2 HM:PFM:REP 206->349|PF02775|6.2e-21|28.6|126/150|TPP_enzyme_C| HM:PFM:REP 9->25|PF00037|2.8e-05|41.2|17/24|Fer4| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00676|IPR001017| GO:PFM GO:0016624|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor"|PF00676|IPR001017| RP:SCP:NREP 2 RP:SCP:REP 8->117|1ti2B2|2e-18|25.0|108/195|d.58.1.5| RP:SCP:REP 166->382|1b0pA2|2e-13|22.1|204/447|c.36.1.12| HM:SCP:REP 8->183|1q16B_|3.5e-35|33.0|176/509|d.58.1.5|1/1|4Fe-4S ferredoxins| HM:SCP:REP 140->436|1b0pA2|2.8e-59|31.4|287/0|c.36.1.12|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 1363 OP:NHOMOORG 383 OP:PATTERN --3132414444444242444335-----1--21311211111332234133224336354-224--- -541---------1------------------------1-1---------------------21--------------16XK2321211111-----------------------------------211-21-2133322222-1---1-----------------1--------------------211-----------------------------1---11111111---------------------2----------------------111--------------------------------------------213--111111111122221111223216--21VU1134154D332321--32------------------31-1---------------------1-------------------1---1--1-1--------2----4-4-------------------------------------------1---111111111111--1-1---------22-11-1-4----31----3----------312-252235426444522315154332242--32-321---11--11111111114222--24---------22442-29355363563D4----31-------84A664-AA8AA999AA-AA9B8A9A8AA9A9AA99557741--8989AAAAAAA99A9A856758889--322222222222------------------333121111-1---1----------1----------------------------1221-----12111----------------21--------------1---------------------------1122222232-1- ---1-------1-------------------------------------------------------------------------------------------------------------------------------------------------------2-------------2-----1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 419 STR:RPRED 94.8 SQ:SECSTR ######cEEEcccccccccGGGGTcTTTEEEEEccccEEEccTTcccccEEETTTTccccccTTTcTTccEEEccccEEEEEcTTTccccccHHHHcGGGccEETTTccHHHHHHHHH#############HHHHHHHHHHHHHHHHHHHTTccccccccTTcHHHHHHHHTTccTTcEEEccTTcHHHHHHTTcGGcccTTcccccccccTTHHHHHHHHHHHHHHTccccEEEEEETGGGGcHHHHHHHHHHHTTccEEEEEEEccEETTEEGGGTccccccGGccccccGcccGGTTcccccHHHGGGGGTTccEEEEETTcHHHHHHHHHHHHHHHHTTcccccEEEEEEccccccccTTcTTccccccTTGGGHHHHHHTTTcccHHHHccccHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHGGG#### DISOP:02AL 1-3,440-443| PSIPRED ccccEEEEEEEHHHcccccHHHHHHHHHHccccccccEEEEEEcccccccHHHHccccccHHHHHcccccEEEccccccEEEcHHHHccccccHHccccccEEEcccccEEEEEcccccccHHHHccHHHHHcccccccEEEccccccccccccHHHccccccHHHHHHHHHHccccEEEEEcccHHEEEccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHcccHHHHHHHHccccEEEEEEcccHHccccccccccccccccEEcccccccccccccccccHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccc //