[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38760.1
DDBJ      :             4-hydroxybenzoyl-CoA reductase beta subunit
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  187/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.87.2
:328 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   32->305 1rm6B PDBj 3e-67 47.3 %
:RPS:PDB   11->282 2ckjA PDBj 2e-21 20.2 %
:RPS:SCOP  13->215 1rm6B2  d.145.1.3 * 1e-43 48.5 %
:RPS:SCOP  219->283 1jroA3  d.87.2.1 * 3e-07 24.6 %
:HMM:SCOP  5->220 1rm6B2 d.145.1.3 * 8.5e-61 43.4 %
:HMM:SCOP  217->324 1rm6B1 d.87.2.1 * 2.2e-21 34.6 %
:RPS:PFM   12->215 PF00941 * FAD_binding_5 1e-20 42.7 %
:HMM:PFM   9->215 PF00941 * FAD_binding_5 3.1e-53 47.9 167/171  
:HMM:PFM   220->318 PF03450 * CO_deh_flav_C 7.1e-13 24.5 98/103  
:BLT:SWISS 32->305 HCRB_THAAR 8e-67 47.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38760.1 GT:GENE ABE38760.1 GT:PRODUCT 4-hydroxybenzoyl-CoA reductase beta subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1698123..1699109) GB:FROM 1698123 GB:TO 1699109 GB:DIRECTION - GB:PRODUCT 4-hydroxybenzoyl-CoA reductase beta subunit GB:PROTEIN_ID ABE38760.1 GB:DB_XREF GI:91682458 InterPro:IPR002346 LENGTH 328 SQ:AASEQ MTDALHSLRLLQPASVDEAVAALAQHPDARLVAGGTDLLVNIRRGVRQPDLLIDAANIAELKQVSGDGDALIIGAGVTIAALADDALIASRYHALAQAAASIAGPGHRRLGTVGGNLCLDTRCIYYNQSEWWRRANAYCLKNRGETCHVAPKGNRCHAAFSGDLAPALLVLGAEIDIAGPGGSRRLPLAELYVEDGKAHLALKPGELVVKVRLPAGPAASAYQKLRVRGAVDYPLAGVSVALARSGADIAQLRIALTGTNSRPFLLAGTDALAQRPLDEAMLKQIDQLVQQQVQPMRTTLMSSNYRRLAAAAIARRLTGELFDSLAAA GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 32->305|HCRB_THAAR|8e-67|47.3|273/324| SEG 79->89|iaaladdalia| SEG 284->294|qidqlvqqqvq| SEG 306->317|rrlaaaaiarrl| BL:PDB:NREP 1 BL:PDB:REP 32->305|1rm6B|3e-67|47.3|273/323| RP:PDB:NREP 1 RP:PDB:REP 11->282|2ckjA|2e-21|20.2|233/1264| RP:PFM:NREP 1 RP:PFM:REP 12->215|PF00941|1e-20|42.7|164/171|FAD_binding_5| HM:PFM:NREP 2 HM:PFM:REP 9->215|PF00941|3.1e-53|47.9|167/171|FAD_binding_5| HM:PFM:REP 220->318|PF03450|7.1e-13|24.5|98/103|CO_deh_flav_C| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00941|IPR002346| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00941|IPR002346| RP:SCP:NREP 2 RP:SCP:REP 13->215|1rm6B2|1e-43|48.5|202/216|d.145.1.3| RP:SCP:REP 219->283|1jroA3|3e-07|24.6|65/117|d.87.2.1| HM:SCP:REP 5->220|1rm6B2|8.5e-61|43.4|212/0|d.145.1.3|1/1|FAD-binding domain| HM:SCP:REP 217->324|1rm6B1|2.2e-21|34.6|107/0|d.87.2.1|1/1|CO dehydrogenase flavoprotein C-terminal domain-like| OP:NHOMO 317 OP:NHOMOORG 191 OP:PATTERN --1----------------------------------------------------------------- 112-2----------------1--23-----11111--11------------1-1-----1-3--363331-----------1------------------1-1-3-2-------------------------------11------1-1-----------------1-2--------------12------------------------------------------------------------------------------------------------------------------------------------------12--1111111-1-----------------1-1---11------------------------12442-133321------------5544343423--11121-221-152--1-1--2122--1--------2--1-11---------------------------------1------1222222-----1123------125223---111--1111---2--------------------1----1-1------------11------------2-------------------------111--1----------------------------------------1--1--222-2---21-22221--2122-2221221------------------------11--1111------------------------------1------------------------111-1111--1111-111322------------------------1122222-------------------------------------------------------1--------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 303 STR:RPRED 92.4 SQ:SECSTR ##GGGcccEEEEcccHHHHHHHHHHcTTcEEccccTTHHHHHHHccccccEEEEccccGGGccEEEcccEEEEETTccHHTTTccTTTTHHHHHHHHHHTTcccHHHHTTccHHHHHHcccccTTTcccHHHHHHTTccTHTTccHHcccTTHHHHcccTTcccHHHHHHHTcccEEEcTTccccccccTTcccccTTcccccTTcEEEEEEEEcccTTEEEEEEEEccccccEEEEEEEEccTTcccccEEEEEEETcccccEEcTHHHHHTTccccHHHHHHHHHHHHHHccccTTccccHHH####################### PSIPRED ccccccccEEEccccHHHHHHHHHHccccEEEEcccHHHHHHHcccccccEEEEcccccccEEEEEEccEEEEEccccHHHHccHHHHHHHHHHHHHHHHHHccHHHHccccccHHHHHcccccccccHHHHcccccccHHccccccEEEEEccHHcccccHHHHHHHHHcccEEEEEEcccEEEEEHHHHcccccccccccccccEEEEEEEEcccccEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEEccccccEEHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc //