[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38768.1
DDBJ      :             pyruvate/2-ketoisovalerate 2-oxoacid:acceptor oxidoreductase, beta subunit
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  256/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:279 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   73->137 3eyaB PDBj 7e-05 32.8 %
:RPS:PDB   24->231 3ea4A PDBj 5e-22 16.6 %
:RPS:SCOP  16->234 1b0pA2  c.36.1.12 * 6e-22 17.8 %
:HMM:SCOP  4->274 1b0pA2 c.36.1.12 * 3.5e-66 34.6 %
:RPS:PFM   58->141 PF02775 * TPP_enzyme_C 8e-07 37.8 %
:HMM:PFM   57->204 PF02775 * TPP_enzyme_C 3.9e-30 33.6 140/150  
:HMM:PFM   208->261 PF12367 * PFO_beta_C 0.00065 20.4 54/67  
:BLT:SWISS 23->211 KORB_METJA 2e-46 45.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38768.1 GT:GENE ABE38768.1 GT:PRODUCT pyruvate/2-ketoisovalerate 2-oxoacid:acceptor oxidoreductase, beta subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1706437..1707276) GB:FROM 1706437 GB:TO 1707276 GB:DIRECTION - GB:PRODUCT pyruvate/2-ketoisovalerate 2-oxoacid:acceptor oxidoreductase, beta subunit GB:PROTEIN_ID ABE38768.1 GB:DB_XREF GI:91682466 InterPro:IPR011766 InterPro:IPR011896 LENGTH 279 SQ:AASEQ MNMIPTEVRALKPADYKSAVKPVWCPGCGDHSVLVAFQRAMAELALPPEQVAVVSGIGCSSRIPSYTSCYGFHGVHGRALAVASGLKVARPDLTVVVASGDGDGFSIGGNHFLHACRRNLDLTYIVMDNRIYGMTKGQPSPTTESDWDTAIAPGGTGLSPFHPLVIALASGANFIARGFTGDVGGCAKLIVDAVRTPGFSFVQILSPCVTFRSDQQKAWKSLVREAIVPETDDPARAARRLMTDDGFNLGVLYRGKRLPYQPRPSDNLTPSHFESEFAI GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 23->211|KORB_METJA|2e-46|45.5|189/270| BL:PDB:NREP 1 BL:PDB:REP 73->137|3eyaB|7e-05|32.8|64/524| RP:PDB:NREP 1 RP:PDB:REP 24->231|3ea4A|5e-22|16.6|205/581| RP:PFM:NREP 1 RP:PFM:REP 58->141|PF02775|8e-07|37.8|82/139|TPP_enzyme_C| HM:PFM:NREP 2 HM:PFM:REP 57->204|PF02775|3.9e-30|33.6|140/150|TPP_enzyme_C| HM:PFM:REP 208->261|PF12367|0.00065|20.4|54/67|PFO_beta_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 1 RP:SCP:REP 16->234|1b0pA2|6e-22|17.8|219/447|c.36.1.12| HM:SCP:REP 4->274|1b0pA2|3.5e-66|34.6|269/0|c.36.1.12|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 523 OP:NHOMOORG 324 OP:PATTERN 22111222111111122232211222222223213112333332213312222123223332222-11 133-1---------11111-11--1111111111111-121222----------------11111111211--------112-2412122232222-1-------1--1----------------1112121211222222---1-----------------------------------------11111-1-111111111111111-1----1111111-1-------1111111111111111111111----------------------------------------------------------------------15312-1--111-1-23------1-1--2--32---232244222313--131---1-------111---11212----------------------------------------1-----------------------1-1------------------------------1111-----------------------------------------------11---1----------------3---352333312233312224222223343--241111111111111111111111111------------------------------11----2----------------------------------------------------------------------------------------------------1111----------------------------------------------------------1------------------------------11------------------------------------------3333233233-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 278 STR:RPRED 99.6 SQ:SECSTR cHHHHHHHHHHHHHHHHTTcccccTTcccHHHHHHHHHHHHTTccEEEEcccHHHHHHcccccTTcEEcccccccTTcHHHHHHHHHHHcTTccEEEEEEHHHGHHHTTTHHHHHHHTTccEEEEEEEccccHHHHHHHHHHcTTcccccccccGGGTTcccccHHHHHHHTTccEEEEcTcGGGHHHHHHHHHHccccEEEEEEccTTccccccccTTcccGGGccccccccHHHHHHHHHHTTTHcHHHHHHHHHHHHHHTTcccccHHHHHHHHH# PSIPRED cccccHHHHHccHHHHccccccccccccccHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccEEEccccccccccccHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHcccccccHHHHHHHHHHcccEEEEEEEccccccccHHHHHHcccHHHHccccc //