[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38777.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->116 2fbiA PDBj 8e-07 33.8 %
:RPS:PDB   20->159 2a61A PDBj 5e-13 22.8 %
:RPS:SCOP  22->160 2fbiA1  a.4.5.28 * 3e-20 27.5 %
:HMM:SCOP  16->156 1jgsA_ a.4.5.28 * 2.6e-26 29.2 %
:HMM:PFM   64->106 PF01047 * MarR 1.7e-07 30.2 43/59  
:BLT:SWISS 17->159 BADR_RHOPA 4e-71 88.1 %
:PROS 81->115|PS01117|HTH_MARR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38777.1 GT:GENE ABE38777.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1717001..1717528) GB:FROM 1717001 GB:TO 1717528 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID ABE38777.1 GB:DB_XREF GI:91682475 InterPro:IPR000835 LENGTH 175 SQ:AASEQ MARNTKSASNTATTKTELANRLFFRLYQCANMLHKTGTRAVEAEGLTTQQWAVLGALSRPVAKAGMSIGDLARYLMVSRQNLAGLIGRMERDGHVAIVPDARDRRSRLVTMTETGRHVWNDLAQPKIRAYYDQVLADFSINDTTHALHYLLKILDNMKRIDDGASDLDADEEPRD GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 17->159|BADR_RHOPA|4e-71|88.1|143/175| PROS 81->115|PS01117|HTH_MARR_1|PDOC00861| SEG 4->16|ntksasntattkt| BL:PDB:NREP 1 BL:PDB:REP 40->116|2fbiA|8e-07|33.8|74/136| RP:PDB:NREP 1 RP:PDB:REP 20->159|2a61A|5e-13|22.8|136/142| HM:PFM:NREP 1 HM:PFM:REP 64->106|PF01047|1.7e-07|30.2|43/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 22->160|2fbiA1|3e-20|27.5|131/136|a.4.5.28| HM:SCP:REP 16->156|1jgsA_|2.6e-26|29.2|137/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 19 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-----------------1------------1------1--1--------------------------------------------------------------1---------------------------121------1-----1---1-------------------1---------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 86.3 SQ:SECSTR ################cHHHHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHcTTHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccHHHHHH######## DISOP:02AL 1-13,159-176| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //