[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38795.1
DDBJ      :             response regulator receiver
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  681/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->205 1a04A PDBj 9e-21 27.5 %
:RPS:PDB   6->210 3c3wA PDBj 4e-24 28.6 %
:RPS:SCOP  3->195 1s8nA  c.23.1.1 * 1e-14 21.9 %
:RPS:SCOP  167->210 1fseF  a.4.6.2 * 1e-10 25.0 %
:HMM:SCOP  1->187 1s8nA_ c.23.1.1 * 7e-20 23.2 %
:RPS:PFM   6->116 PF00072 * Response_reg 1e-09 29.4 %
:RPS:PFM   151->204 PF00196 * GerE 5e-09 50.0 %
:HMM:PFM   152->205 PF00196 * GerE 2.5e-19 50.0 54/58  
:HMM:PFM   6->116 PF00072 * Response_reg 9.4e-17 25.5 110/112  
:BLT:SWISS 4->204 DESR_BACSU 3e-23 31.9 %
:PROS 1->34|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38795.1 GT:GENE ABE38795.1 GT:PRODUCT response regulator receiver GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1738068..1738733) GB:FROM 1738068 GB:TO 1738733 GB:DIRECTION - GB:PRODUCT response regulator receiver GB:PROTEIN_ID ABE38795.1 GB:DB_XREF GI:91682493 InterPro:IPR000792 InterPro:IPR001789 InterPro:IPR010916 LENGTH 221 SQ:AASEQ MSRVSVALVDDHPLMIEAVFSLLSRIDSFEVVATGTSAKDVVDIGTLLRPEIMIVDLGLPGDVYAAIASVASNSCGTKLVAFTASTGVDTAIRALDSGASGYVLKGSSPDELLDAIASVRSGETYITRNFATQVISALRDATIRRRAAMAVKLSIREEQIVRLLLKGKTNKEIAHAISISEKTVKHYMTILMQKLQVRNRLEVVIAAQRLDAERQLPRLHS GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 4->204|DESR_BACSU|3e-23|31.9|188/199| PROS 1->34|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 5->205|1a04A|9e-21|27.5|193/205| RP:PDB:NREP 1 RP:PDB:REP 6->210|3c3wA|4e-24|28.6|203/211| RP:PFM:NREP 2 RP:PFM:REP 6->116|PF00072|1e-09|29.4|109/111|Response_reg| RP:PFM:REP 151->204|PF00196|5e-09|50.0|54/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 152->205|PF00196|2.5e-19|50.0|54/58|GerE| HM:PFM:REP 6->116|PF00072|9.4e-17|25.5|110/112|Response_reg| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 3->195|1s8nA|1e-14|21.9|187/190|c.23.1.1| RP:SCP:REP 167->210|1fseF|1e-10|25.0|44/50|a.4.6.2| HM:SCP:REP 1->187|1s8nA_|7e-20|23.2|185/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 3313 OP:NHOMOORG 685 OP:PATTERN -------------------------------------------------------------------- ACF3Z45644331164422-25--592222238666AHFE487NCG744A75666244--69F6RBNRYQ82222313-33-8-----11---------3-8233F4I33-------------------1------8AA9A779F6C55833232111--1--352AA9C2------------57622--24695555567647556779799595872636522222222DA344434434444444344431---22-1--1221222221---1111222323233111111111112222222222212212222222216172111122111111--1---5-1--C111-75112125-21111---7112221-----16G474123455622222222223-76779AA6496-544365567678321124136645335---------1112732------------------------------142--432236569A56444266AG7778176ABAGHJ-2A998B5558989935927836331111111-1284723612162-42331-21421442433333341--1---------------------1--761532856325656735567746558478---1322------84455756885754577-8777656666857556555444665437677777777677777766655653-666666566666--334444411111363311111211111-112222222221224AAB89FAD988986879---------2354556666694999898A875562222112-442222--------2-------------------------------------3I- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------2--2-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 98.2 SQ:SECSTR EccEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHcccEEEEccEETTEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHEEHHccTTTTccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHcHHcccc#### DISOP:02AL 1-1,134-152,213-222| PSIPRED cccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccc //