[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38801.1
DDBJ      :             GtrA-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->138 PF04138 * GtrA 3e-08 31.9 %
:HMM:PFM   24->138 PF04138 * GtrA 6.4e-25 37.7 114/117  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38801.1 GT:GENE ABE38801.1 GT:PRODUCT GtrA-like protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1755628..1756074) GB:FROM 1755628 GB:TO 1756074 GB:DIRECTION - GB:PRODUCT GtrA-like protein GB:PROTEIN_ID ABE38801.1 GB:DB_XREF GI:91682499 InterPro:IPR007267 LENGTH 148 SQ:AASEQ MHPQLRRLSDLRISRSLASKMVAFASIGVVNTFIDLGVFALAYKVFELPIVLANVLAWLVAASCSYVMNTMITFRVESGRVLKTKDYLSFVASGLLGLIANTTTLVVLSAYVPVFTAKLVAIVVSFVVNFSMSHLVVFRRKPAHGSDG GT:EXON 1|1-148:0| TM:NTM 4 TM:REGION 20->42| TM:REGION 48->70| TM:REGION 89->111| TM:REGION 117->138| SEG 5->19|lrrlsdlrisrslas| SEG 51->62|vlanvlawlvaa| RP:PFM:NREP 1 RP:PFM:REP 24->138|PF04138|3e-08|31.9|113/116|GtrA| HM:PFM:NREP 1 HM:PFM:REP 24->138|PF04138|6.4e-25|37.7|114/117|GtrA| GO:PFM:NREP 3 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF04138|IPR007267| GO:PFM GO:0006810|"GO:transport"|PF04138|IPR007267| GO:PFM GO:0016021|"GO:integral to membrane"|PF04138|IPR007267| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,141-141,143-149| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccEEEEHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccccc //