[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38831.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:380 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   107->319 PF12281 * DUF3620 3e-43 52.2 %
:HMM:PFM   109->324 PF12281 * DUF3620 6.8e-74 46.2 210/217  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38831.1 GT:GENE ABE38831.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1788719..1789861 GB:FROM 1788719 GB:TO 1789861 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38831.1 GB:DB_XREF GI:91682529 LENGTH 380 SQ:AASEQ MAVSAALDISYQTLYSELVQRSLDDSFTSEFSTDGRFVAVTVKTRKYWYFDTPKSEGGAQNRRYVGPVDDPEITKRVEAFKDLKADLKGRRRLVATLTRQAYLPRPLLKSGQVVEELAKAGFFRLRGVLVGTVAYQCYPGVLGRRLDATAMQTGDADFAQFHEISVAVGDSLPPILDVLHRVDETFREIPSQVDGRVSTQFVSRDKFKVEFLTPHRGPDDIAGKPVQMPALGGAAAFPLRFLDFLIRHPVRAVLMHGAGVPVLVPSPDRYAVHKLIVGSRRKEDRDTASKAAKDRLQAKSIMEAMIANRQQDDLAAAYMEAWDRGDHWVAAIRISLATYDDQFRGLLGCELGKGIKNNGGEPSDYGLDDEPKGTATPGPR GT:EXON 1|1-380:0| RP:PFM:NREP 1 RP:PFM:REP 107->319|PF12281|3e-43|52.2|205/211|DUF3620| HM:PFM:NREP 1 HM:PFM:REP 109->324|PF12281|6.8e-74|46.2|210/217|DUF3620| OP:NHOMO 37 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------------11--------------2---11--1--122-222111-1---2-1-111-1-1---------------1----------------------------------------------------------------------1----------1-------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,280-293,372-381| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEcccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHcccccccccccccccHHHcccccHHcccccccHHHHHHHHHHHHHHcccccccccEEEEEccccEEEEEEcccccccccccccccccccccEEcccccHHHHHccccccEEEEcccccEEEcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHcccccccccccccccccccccccc //