[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38840.1
DDBJ      :             Prevent-host-death protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.306.1
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->49 2odkD PDBj 7e-07 47.7 %
:RPS:PDB   4->50 2a6qB PDBj 3e-08 25.5 %
:RPS:SCOP  6->49 2odkA1  d.306.1.1 * 6e-11 47.7 %
:HMM:SCOP  3->69 2a6qA1 d.306.1.1 * 5e-11 29.9 %
:RPS:PFM   3->50 PF02604 * PhdYeFM 1e-05 35.4 %
:HMM:PFM   4->52 PF02604 * PhdYeFM 6e-19 34.7 49/75  
:BLT:SWISS 5->50 Y4EA_RHISN 2e-05 30.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38840.1 GT:GENE ABE38840.1 GT:PRODUCT Prevent-host-death protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1798294..1798551) GB:FROM 1798294 GB:TO 1798551 GB:DIRECTION - GB:PRODUCT Prevent-host-death protein GB:PROTEIN_ID ABE38840.1 GB:DB_XREF GI:91682538 InterPro:IPR003756 InterPro:IPR006442 LENGTH 85 SQ:AASEQ MAERSWSVQDAKNRFSEVVEAARRSPQTVTKHGKPAVVVVDVTEYQRLQQLERAHAPSFADVLLAMPQDDGDFSRDAVRMRDLDL GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 5->50|Y4EA_RHISN|2e-05|30.4|46/100| BL:PDB:NREP 1 BL:PDB:REP 6->49|2odkD|7e-07|47.7|44/51| RP:PDB:NREP 1 RP:PDB:REP 4->50|2a6qB|3e-08|25.5|47/58| RP:PFM:NREP 1 RP:PFM:REP 3->50|PF02604|1e-05|35.4|48/70|PhdYeFM| HM:PFM:NREP 1 HM:PFM:REP 4->52|PF02604|6e-19|34.7|49/75|PhdYeFM| RP:SCP:NREP 1 RP:SCP:REP 6->49|2odkA1|6e-11|47.7|44/51|d.306.1.1| HM:SCP:REP 3->69|2a6qA1|5e-11|29.9|67/0|d.306.1.1|1/1|YefM-like| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111----1----------------------1-----------11---1-------1----------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 76.5 SQ:SECSTR ccccEEEHHHHHHHHHHHHHHHHHHcEEEEccccccEEEccHHHHHHHHHHHHHTcHHHHHHHHc#################### DISOP:02AL 1-4,82-82| PSIPRED ccHHHccHHHHHHHHHHHHHHHccccEEEEEccEEEEEEEcHHHHHHHHHHHHHccccHHHHHHHccccccccHHHccccccccc //