[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38849.1
DDBJ      :             phosphoheptose isomerase
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  424/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.80.1
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->190 1x92B PDBj 1e-37 46.2 %
:RPS:PDB   43->186 2a3nA PDBj 6e-15 13.9 %
:RPS:SCOP  44->187 1tk9A  c.80.1.3 * 2e-49 57.6 %
:HMM:SCOP  1->193 1x92A_ c.80.1.3 * 5.4e-45 34.0 %
:RPS:PFM   113->169 PF01380 * SIS 7e-07 42.1 %
:HMM:PFM   111->179 PF01380 * SIS 3.9e-09 22.4 67/131  
:BLT:SWISS 6->190 GMHA_BRASO 1e-59 62.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38849.1 GT:GENE ABE38849.1 GT:PRODUCT phosphoheptose isomerase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1806042..1806629) GB:FROM 1806042 GB:TO 1806629 GB:DIRECTION - GB:PRODUCT phosphoheptose isomerase GB:PROTEIN_ID ABE38849.1 GB:DB_XREF GI:91682547 InterPro:IPR001347 InterPro:IPR004515 LENGTH 195 SQ:AASEQ MSQDRIAAHFHNSLVAMTAAVGDEAVLSASRAIAAASIAALRDGRKILIAGNGGSAADAQHIAAEIIGRYKQDRPAWPAIALTTDTSALTAIANDYGFDQVFARQVEGLGQRGDVFIGITTSGRSPNILAALKMARERGLVTIGMTGPSGVSMAAWCDHLLVAPGAETALVQQIHLMAAHAICDEIESVLGATKA GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 6->190|GMHA_BRASO|1e-59|62.2|185/198| SEG 27->42|lsasraiaaasiaalr| BL:PDB:NREP 1 BL:PDB:REP 46->190|1x92B|1e-37|46.2|145/197| RP:PDB:NREP 1 RP:PDB:REP 43->186|2a3nA|6e-15|13.9|122/325| RP:PFM:NREP 1 RP:PFM:REP 113->169|PF01380|7e-07|42.1|57/131|SIS| HM:PFM:NREP 1 HM:PFM:REP 111->179|PF01380|3.9e-09|22.4|67/131|SIS| GO:PFM:NREP 2 GO:PFM GO:0005529|"GO:sugar binding"|PF01380|IPR001347| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01380|IPR001347| RP:SCP:NREP 1 RP:SCP:REP 44->187|1tk9A|2e-49|57.6|144/188|c.80.1.3| HM:SCP:REP 1->193|1x92A_|5.4e-45|34.0|188/0|c.80.1.3|1/1|SIS domain| OP:NHOMO 598 OP:NHOMOORG 430 OP:PATTERN -----------------------------------111-----------------------111---- 112------------2111-1---1111111-----1-11-1-------11-111-----11---33-1-------------111111--1--------------111----------------11111111111221122-1111-1-1111-----------1------1-1-11-----------111--------------------------------------------------------------------------------------11-----------------------------------------------1--------1------------------1-------------1--1111------------1231112-12--------------------1-11----------1--1-----1----------------1---1211-----------------------------1---1-11111111111122221111222221111122111---11-111112-11111212211111111-11111-21--1111221111111111111-----1111111-2221211111111112111-222221211-1221111111111111111111--1111-1--11122222222222222222-2222222222222222222222222322222222222222222222222222-222222222232113111111111111311222222211222222----------1111111111211111111111111111122222222222222----------------11112222----------------------------------------------221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 96.4 SQ:SECSTR ##HHHHHHHHHHHHHHHHHHH##HHcHHHHHHHHHHHHHHHHccccEEEEEcGGGHHHHHHHHHHHccTTGGGcTTccEEEEcccTHHHccccEEEEEHHHHHHHccTTccTTcEEEEEccccccHHHHHHHHHHHHTTcEEEEEEccTTcHHHHTccEEEEcccccHHHHHHHHHHHHHHHHHTTHHHHTc### DISOP:02AL 1-1,194-196| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcHHHcccccccEEEccccHHHHHHHHccccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccc //