[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38871.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  211/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:402 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  23->335 1pv6A  f.38.1.2 * 1e-15 14.2 %
:HMM:SCOP  10->396 1pv7A_ f.38.1.2 * 2.5e-33 20.8 %
:RPS:PFM   107->339 PF03825 * Nuc_H_symport 2e-06 26.2 %
:HMM:PFM   21->381 PF03825 * Nuc_H_symport 7.3e-16 21.7 359/400  
:BLT:SWISS 21->340 HCAT_ECOLI 6e-31 33.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38871.1 GT:GENE ABE38871.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1832347..1833555 GB:FROM 1832347 GB:TO 1833555 GB:DIRECTION + GB:PRODUCT major facilitator superfamily MFS_1 GB:PROTEIN_ID ABE38871.1 GB:DB_XREF GI:91682569 InterPro:IPR004740 InterPro:IPR011701 LENGTH 402 SQ:AASEQ MSTESGIPIRTKAPKRFAAGLAVFYATVFGVTGAYLPFFTVWLKAIGIEAWWIGIIVATPAITRFTVLPFITAEAERRQALRAALVITAIVTTIGFICLGVLRGPLAILAVFMVTACAWTPMVPLTDGYALKAVARFGLNYGPLRLWGSAAFVVSALVSGALADIISPEHLIWLIAASAGLGVIAALGLQPLDAPGARQGPARRVALLRNPAFLAIIIPAGMIQGSHAAYYTFGSIVWQGAGYSGMTIASLWVLGVLAEIVVFALSPRFTLSPALMMLGGALSAVVRWLITAQDPPLAVLVAVQLLHGLTFGLTQLGTMGLLIRHAPGHVIARAQGYYTACSGLAMSSAAMLSGALFERYGLAVYDLMAVMAFTAAVVVVVSRRRLEAQPASDQPHSPGSGG GT:EXON 1|1-402:0| BL:SWS:NREP 1 BL:SWS:REP 21->340|HCAT_ECOLI|6e-31|33.9|316/379| TM:NTM 10 TM:REGION 19->41| TM:REGION 51->73| TM:REGION 88->110| TM:REGION 146->168| TM:REGION 172->194| TM:REGION 210->232| TM:REGION 244->266| TM:REGION 270->292| TM:REGION 299->321| TM:REGION 361->382| SEG 45->56|aigieawwigii| SEG 73->85|aeaerrqalraal| SEG 297->306|lavlvavqll| SEG 342->356|sglamssaamlsgal| SEG 369->381|avmaftaavvvvv| RP:PFM:NREP 1 RP:PFM:REP 107->339|PF03825|2e-06|26.2|229/389|Nuc_H_symport| HM:PFM:NREP 1 HM:PFM:REP 21->381|PF03825|7.3e-16|21.7|359/400|Nuc_H_symport| GO:PFM:NREP 3 GO:PFM GO:0005337|"GO:nucleoside transmembrane transporter activity"|PF03825|IPR004740| GO:PFM GO:0015858|"GO:nucleoside transport"|PF03825|IPR004740| GO:PFM GO:0016021|"GO:integral to membrane"|PF03825|IPR004740| RP:SCP:NREP 1 RP:SCP:REP 23->335|1pv6A|1e-15|14.2|309/417|f.38.1.2| HM:SCP:REP 10->396|1pv7A_|2.5e-33|20.8|385/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 215 OP:NHOMOORG 211 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11--------------------------------------------------------------------------------------------------------------------------------------------------------1111-------111---11111-----------------1-1-11-1---111111111-111-----------------------1-1-----------------------------------1-----------------------------1111-------------1---11-111----------1111-1-1-----------------------------------------------------111111111-1-1-1111111------11------1111------111111-1111111111-111111111111111111111111111111111111111111111111111--111111111111-------------111--111111111111111--11--1---1122221111111111111---------11111111111111111----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-10,190-205,387-403| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc //