[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38888.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   67->158 PF09917 * DUF2147 8e-10 31.1 %
:HMM:PFM   37->158 PF09917 * DUF2147 4.4e-28 31.0 113/114  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38888.1 GT:GENE ABE38888.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1860031..1860687 GB:FROM 1860031 GB:TO 1860687 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38888.1 GB:DB_XREF GI:91682586 LENGTH 218 SQ:AASEQ MNTHRPIRLFAMAAAAVVSFLMSAPAPVAAAEPTAVGLWQRTDNGKPTGKPVVWVLMLDRGNNMYEGVVAKSFAQPGQPNLTVCEECEDDRKGQPILGISLIRDMKRKGRVYEGGNILDPRNGDVWKAMLTVSPDGQDLTLRGYLLTPALGQDETWQRLPDTAIAQIDPVIVAKFMPEQAAALAAKPGATAGKPKATTPAPAPAPMQKGGMMAPAPAK GT:EXON 1|1-218:0| SEG 24->36|apapvaaaeptav| SEG 180->205|aaalaakpgatagkpkattpapapap| RP:PFM:NREP 1 RP:PFM:REP 67->158|PF09917|8e-10|31.1|90/113|DUF2147| HM:PFM:NREP 1 HM:PFM:REP 37->158|PF09917|4.4e-28|31.0|113/114|DUF2147| OP:NHOMO 95 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------1-11-------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111----------------------2------------------------------------------------------------------------------------111111111111111111111111111111111-11111-122--------11------------1----------------------------11--------------------------------------1------------------------------------------------------------------------------------------------------------------------111-11111--------------------2222211--11--------------1---------------------------1-11111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,187-203,215-219| PSIPRED cccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccccccEEEEEEEEccccEEEEEEEEEcccccccccccccccccccccccEEcccEEEccccccccccccEEEccccccEEEEEEEEEccccEEEEEEEEEEcccccccEEEEcccccHHHccHHHHHHHccHHHHHHHcccccccccccccccccccccHHHcccccccccc //