[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38893.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  212/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:353 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->306 PF03706 * UPF0104 3e-11 29.6 %
:HMM:PFM   38->306 PF03706 * UPF0104 3.2e-19 23.1 260/294  
:BLT:SWISS 62->318 Y712_SYNY3 9e-29 31.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38893.1 GT:GENE ABE38893.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1866753..1867814) GB:FROM 1866753 GB:TO 1867814 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38893.1 GB:DB_XREF GI:91682591 LENGTH 353 SQ:AASEQ MHRLLSALGRGFKTYVGWKRLGIVASVLIIGFAITSLFRTLKGVDSAVILTALTEKSPGQIGMAALCVVGAFCTLTFYDFFALRTIGKLHVPYRIAALSSFTSYVIGHNLGATVFTGGAIRFRIYSDYGLSAIDVAKICFISGLTFWLGNLFVLGIGMIWHPAAASAMDLLPDSINQLIGVACLTGIAAYFLWLATGKKRRELGQNGWKVVLPSARLTLLQVLIGVVDLGFCALAMYMLMPAEPYIDFVSLAVVFILATLLGFASHAPGSLGVFDAAMLVALPMFPREDIIATLLIYRVLYFLLPFGIAISILGVRELWLSVVKPWHEKRAGNGHPVTAATPVRQIGRTSSKL GT:EXON 1|1-353:0| BL:SWS:NREP 1 BL:SWS:REP 62->318|Y712_SYNY3|9e-29|31.6|253/322| TM:NTM 9 TM:REGION 21->43| TM:REGION 59->81| TM:REGION 87->109| TM:REGION 139->161| TM:REGION 170->192| TM:REGION 215->237| TM:REGION 243->265| TM:REGION 269->291| TM:REGION 296->318| RP:PFM:NREP 1 RP:PFM:REP 37->306|PF03706|3e-11|29.6|267/291|UPF0104| HM:PFM:NREP 1 HM:PFM:REP 38->306|PF03706|3.2e-19|23.1|260/294|UPF0104| OP:NHOMO 278 OP:NHOMOORG 216 OP:PATTERN --------------------------------------------------111--------------- --------------------------------------------2------------------------------------------------------------------------------------------------------21-331----------11--1-1--------------------------------1-----------------------11111----------------------1-----------------------------------------------------------------------------------------------------------------------1-1----11111222332222222222222222222-2232222221--12222232223311------1-11-1-11111111-1111-22-------------------------------12--------1111-1----11-1------11--1----11--1-----1---------------------------1-----1----11---------11-1-------------------------------1-----------1111---111---------------------11---1-1111111111-1111111111111111111111-----1111111111111111-11-111------------------------------------------------------1--11111111111211112111------------------------1-111111111111----------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,348-354| PSIPRED ccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccccHHHHHcHHccc //