[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38912.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   56->103 PF10135 * Rod-binding 6e-08 41.7 %
:HMM:PFM   57->103 PF10135 * Rod-binding 1.1e-16 38.3 47/49  
:BLT:SWISS 36->109 CHEL_CAUCR 7e-12 40.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38912.1 GT:GENE ABE38912.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1893117..1893461) GB:FROM 1893117 GB:TO 1893461 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38912.1 GB:DB_XREF GI:91682610 LENGTH 114 SQ:AASEQ MMSIVPVTYSHVAPSYNGRPDIALTEALAQVSPKAQAKAHKSAQDFEAMFLNSMFSQMTSGLKGDGPFGDTVGTGVWRSMLTDQYAQTVAKAGGVGIASDVFRTLILQQANRAA GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 36->109|CHEL_CAUCR|7e-12|40.5|74/111| RP:PFM:NREP 1 RP:PFM:REP 56->103|PF10135|6e-08|41.7|48/49|Rod-binding| HM:PFM:NREP 1 HM:PFM:REP 57->103|PF10135|1.1e-16|38.3|47/49|Rod-binding| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------11111111111--------------1--111--1---------------1---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,5-6,17-42,57-73,104-115| PSIPRED cccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccc //