[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38916.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->86 PF12071 * DUF3551 2e-13 60.0 %
:HMM:PFM   6->76 PF12071 * DUF3551 5.6e-32 47.9 71/82  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38916.1 GT:GENE ABE38916.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1895991..1896257) GB:FROM 1895991 GB:TO 1896257 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38916.1 GB:DB_XREF GI:91682614 LENGTH 88 SQ:AASEQ MTRTSAVLFAAATVVSLAAAPAQARDFPYCLQGGEWGYPGNCQFDSYQQCVTTASGTRAYCDINPVFAFRAQQEPQSQPRSHHHQRRY GT:EXON 1|1-88:0| SEG 4->24|tsavlfaaatvvslaaapaqa| RP:PFM:NREP 1 RP:PFM:REP 25->86|PF12071|2e-13|60.0|55/82|DUF3551| HM:PFM:NREP 1 HM:PFM:REP 6->76|PF12071|5.6e-32|47.9|71/82|DUF3551| OP:NHOMO 20 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1212-123224------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,70-89| PSIPRED cccHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccHHHHHHccccccccccccccEEEcccccccccHHHHHHHccc //