[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38921.1
DDBJ      :             flagellar basal body-associated protein FliL
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   85->129 2b92B PDBj 2e-04 28.9 %
:RPS:PFM   58->167 PF03748 * FliL 6e-10 35.2 %
:HMM:PFM   22->167 PF03748 * FliL 2.5e-38 34.7 144/149  
:BLT:SWISS 69->166 FLIL_CAUCR 2e-17 39.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38921.1 GT:GENE ABE38921.1 GT:PRODUCT flagellar basal body-associated protein FliL GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1900346..1900849 GB:FROM 1900346 GB:TO 1900849 GB:DIRECTION + GB:PRODUCT flagellar basal body-associated protein FliL GB:PROTEIN_ID ABE38921.1 GB:DB_XREF GI:91682619 InterPro:IPR005503 LENGTH 167 SQ:AASEQ MADSEKPEEGAEAAEGAAPKSKKKLIIIIAAAALLLIGGGAAAWFFLFAGHKDDKHHAEAAEKVKPPSFIEVPEIMVNLAGSPGERVQYLKAKIVLEVKDEKLVEQIKPTMPRITDLFQTYLRELRSGDLNGSVGMFRMKEELTRRVNVAIAPAQVSALLFKEVLVQ GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 69->166|FLIL_CAUCR|2e-17|39.2|97/167| TM:NTM 2 TM:REGION 26->48| TM:REGION 147->167| SEG 4->50|sekpeegaeaaegaapkskkkliiiiaaaallligggaaawfflfag| RP:PDB:NREP 1 RP:PDB:REP 85->129|2b92B|2e-04|28.9|45/290| RP:PFM:NREP 1 RP:PFM:REP 58->167|PF03748|6e-10|35.2|108/149|FliL| HM:PFM:NREP 1 HM:PFM:REP 22->167|PF03748|2.5e-38|34.7|144/149|FliL| GO:PFM:NREP 3 GO:PFM GO:0001539|"GO:ciliary or flagellar motility"|PF03748|IPR005503| GO:PFM GO:0006935|"GO:chemotaxis"|PF03748|IPR005503| GO:PFM GO:0009425|"GO:bacterial-type flagellum basal body"|PF03748|IPR005503| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------11111111111------------11111111--1---------------1-----------------------1-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 26.9 SQ:SECSTR ####################################################################################HHHHHHHHHHHHHccccccGGGccccHHHHHHHHHHHHHHHcccc###################################### DISOP:02AL 1-20,51-66,128-130,132-132| PSIPRED cccccccHHHHHHHHccccccccEEEEEEEHHHHHHHcccHHHHHHHHcccccHHccccccccccccEEEEcccEEEEEEcccccEEEEEEEEEEEEEccHHHHHHHHHccHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEc //