[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38925.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:PROS 69->80|PS00436|PEROXIDASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38925.1 GT:GENE ABE38925.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1903346..1903675) GB:FROM 1903346 GB:TO 1903675 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38925.1 GB:DB_XREF GI:91682623 InterPro:IPR002016 LENGTH 109 SQ:AASEQ MLLKGLYKVEFETPRRKAVGVVFADSGRLRGGSSAFAYIGYYEQDGGSIRGKITSRRHTSDPSQPSVFGLDEVRVDFHGSSIGDYAQVEGVAAESPSLGFKAVLTRICD GT:EXON 1|1-109:0| PROS 69->80|PS00436|PEROXIDASE_2|PDOC00394| OP:NHOMO 13 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------411---2-22--------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 108-110| PSIPRED cccccEEEEEEEcccccEEEEEEEEccEEEcccEEEEEEEEEEEEccEEEEEEEEEEEcccccccccccccEEEEEEEEEEcccEEEEEEEEccccccEEEEEEEEccc //