[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38929.1
DDBJ      :             putative flagellar basal-body rod protein FlgB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->39 PF00460 * Flg_bb_rod 2.6e-07 25.0 20/31  
:BLT:SWISS 10->123 FLGB_SHIFL 4e-07 33.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38929.1 GT:GENE ABE38929.1 GT:PRODUCT putative flagellar basal-body rod protein FlgB GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1909962..1910372 GB:FROM 1909962 GB:TO 1910372 GB:DIRECTION + GB:PRODUCT putative flagellar basal-body rod protein FlgB GB:PROTEIN_ID ABE38929.1 GB:DB_XREF GI:91682627 LENGTH 136 SQ:AASEQ MAVNDLSMLAALRTKMQWHQERQKVLSENVSNSDTPNFQPRDLVEPKFDSTGRVTASTSGGALPMMMTSTSHLKPPGGTVSFSEDRRIGFQTRPAGNAVTLEDQMMKVSANQMDYAAATSLYSRSLGLIKTAIGKR GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 10->123|FLGB_SHIFL|4e-07|33.6|110/138| HM:PFM:NREP 1 HM:PFM:REP 20->39|PF00460|2.6e-07|25.0|20/31|Flg_bb_rod| OP:NHOMO 31 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------11111111111------------11111111--1-----------------1--1-1------------------121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,50-86,89-89,136-137| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHcccccHHHHHHHHHHccccccccccccHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //