[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38943.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->86 PF00582 * Usp 0.00097 12.1 66/140  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38943.1 GT:GENE ABE38943.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1921610..1921981) GB:FROM 1921610 GB:TO 1921981 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE38943.1 GB:DB_XREF GI:91682641 LENGTH 123 SQ:AASEQ MALRWRVCGLLDSYVAISSALKDRDDDDAPTDLINFIDDDIRQARDHPFQCTDLGPGPSHQRERCQQFGAAEQPRNDTLCRRRAVCCDPSVDAFEIGQRLIVEDELHSSGCVPSRAIRSRASS GT:EXON 1|1-123:0| HM:PFM:NREP 1 HM:PFM:REP 13->86|PF00582|0.00097|12.1|66/140|Usp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,61-72,119-124| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHcc //