[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38947.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->36 PF03550 * LolB 0.00082 23.3 30/157  
:REPEAT 3|4->15|45->64|70->88

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38947.1 GT:GENE ABE38947.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1925990..1926286) GB:FROM 1925990 GB:TO 1926286 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38947.1 GB:DB_XREF GI:91682645 LENGTH 98 SQ:AASEQ MAVDGNWKITMSTPMGERQADLTLKADGTTLTGTQSADGDAGEIFDGTVNGDDVAWKLSITNPMPLTLSYSGKVSGDSISGEMGIGPMGSFPFSGARA GT:EXON 1|1-98:0| NREPEAT 1 REPEAT 3|4->15|45->64|70->88| HM:PFM:NREP 1 HM:PFM:REP 7->36|PF03550|0.00082|23.3|30/157|LolB| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------111---11111--------------------------------------1----------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,33-41,98-99| PSIPRED cccccEEEEEEEcccccccEEEEEEEcccEEEEEccccccEEEEEccEEcccEEEEEEEccccEEEEEEEEEEEcccEEEEEEEEcccccccEEcEEc //