[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38956.1
DDBJ      :             type IV pilus assembly PilZ
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.2
:79 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->78 1ywuA1  b.45.2.1 * 3e-10 11.5 %
:HMM:SCOP  1->80 1ywuA1 b.45.2.1 * 2e-08 22.5 %
:HMM:PFM   3->78 PF07238 * PilZ 9.1e-10 19.7 76/102  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38956.1 GT:GENE ABE38956.1 GT:PRODUCT type IV pilus assembly PilZ GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1934152..1934391) GB:FROM 1934152 GB:TO 1934391 GB:DIRECTION - GB:PRODUCT type IV pilus assembly PilZ GB:PROTEIN_ID ABE38956.1 GB:DB_XREF GI:91682654 InterPro:IPR009875 LENGTH 79 SQ:AASEQ MTERRGAPRHRVFKRGTIAFSGAGFDCTVRNLSATGARIDVEAPVALPEEFVLVIETDKVKHRCRPVWVAARRIGVAFQ GT:EXON 1|1-79:0| HM:PFM:NREP 1 HM:PFM:REP 3->78|PF07238|9.1e-10|19.7|76/102|PilZ| RP:SCP:NREP 1 RP:SCP:REP 1->78|1ywuA1|3e-10|11.5|78/125|b.45.2.1| HM:SCP:REP 1->80|1ywuA1|2e-08|22.5|80/0|b.45.2.1|1/1|PilZ domain-like| OP:NHOMO 22 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------21221211222--------------1----1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccccEEEEEEccEEEEccccccEEEEEEccccEEEEEccccccccEEEEEEccccEEEEEEEEEEEccEEEEEEc //