[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38960.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->43 PF12172 * DUF35_N 0.00075 35.7 14/37  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38960.1 GT:GENE ABE38960.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1936772..1936942) GB:FROM 1936772 GB:TO 1936942 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE38960.1 GB:DB_XREF GI:91682658 LENGTH 56 SQ:AASEQ MSHVIYKCPRTAMKVQAWVAEEHPQAASTFELVRCPACTQVHFVNRADGKLLGDKS GT:EXON 1|1-56:0| HM:PFM:NREP 1 HM:PFM:REP 30->43|PF12172|0.00075|35.7|14/37|DUF35_N| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,54-57| PSIPRED cccEEEEccccccHHHHHHHHHcccccccccEEEcccccEEEEEEHHHcccccccc //