[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38965.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->49 PF09788 * Tmemb_55A 2.6e-06 29.3 41/254  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38965.1 GT:GENE ABE38965.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1939301..1939561) GB:FROM 1939301 GB:TO 1939561 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38965.1 GB:DB_XREF GI:91682663 LENGTH 86 SQ:AASEQ MTMQLAPSKPPDKIRVLCTKCRVPFREKIKNIREGAQVQCPTCNKLITFSSDSADLGVQRAFTEVRRIKNGMLLSIHRGSGDGVMD GT:EXON 1|1-86:0| HM:PFM:NREP 1 HM:PFM:REP 7->49|PF09788|2.6e-06|29.3|41/254|Tmemb_55A| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,82-87| PSIPRED cccccccccccHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEccccccccc //