[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38969.1
DDBJ      :             glycine cleavage system T protein
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  634/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
b.44.2d.250.1
:382 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->380 3girA PDBj 2e-76 46.8 %
:RPS:SCOP  10->294 1pj5A4  d.250.1.1 * 4e-66 24.3 %
:RPS:SCOP  296->382 1v5vA1  b.44.2.1 * 9e-23 32.1 %
:HMM:SCOP  8->295 1v5vA2 d.250.1.1 * 5.9e-82 49.3 %
:HMM:SCOP  285->382 1vloA1 b.44.2.1 * 1.9e-27 41.1 %
:RPS:PFM   55->262 PF01571 * GCV_T 5e-46 54.2 %
:RPS:PFM   280->370 PF08669 * GCV_T_C 1e-11 40.4 %
:HMM:PFM   55->264 PF01571 * GCV_T 3.9e-66 52.7 203/211  
:HMM:PFM   278->372 PF08669 * GCV_T_C 8.3e-26 44.1 93/95  
:BLT:SWISS 10->382 GCST_DICDI 5e-84 47.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38969.1 GT:GENE ABE38969.1 GT:PRODUCT glycine cleavage system T protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1945247..1946395) GB:FROM 1945247 GB:TO 1946395 GB:DIRECTION - GB:PRODUCT glycine cleavage system T protein GB:PROTEIN_ID ABE38969.1 GB:DB_XREF GI:91682667 InterPro:IPR006222 InterPro:IPR006223 LENGTH 382 SQ:AASEQ MLARDDAAALKRTPLHALHLARGGKMVPFAGYDMPVQFAPGVLKEHLHNRAHAGLFDVSHMGQIELRAKSGKLDDAARALERLVPQDIAALPPGRQRYAQFTNESGGILDDLMVTNLGDRLFLVVNAACKAEDEAHLRAHLSETCEITALPERALLALQGPKAEAALGHFCADIGKLRFMDVAELTLMGLRCYVSRSGYTGEDGFEISVPADGAEAFAQALLDHPDVLPIGLGARDSLRLEAGLCLYGHDIDTTTSPVESRLSWSIQKSRRSGGARPGGFLGANAILAQLDQGTARIRVGFRPEGRAPVREGATLYAGADAAEPIGSVTSGGFGPSLNAPVAMGYLPTAQAAIGTVVFAEVRGQRLPLRVAAMPFVPNTYKR GT:EXON 1|1-382:0| BL:SWS:NREP 1 BL:SWS:REP 10->382|GCST_DICDI|5e-84|47.5|362/403| BL:PDB:NREP 1 BL:PDB:REP 9->380|3girA|2e-76|46.8|357/361| RP:PFM:NREP 2 RP:PFM:REP 55->262|PF01571|5e-46|54.2|203/211|GCV_T| RP:PFM:REP 280->370|PF08669|1e-11|40.4|89/94|GCV_T_C| HM:PFM:NREP 2 HM:PFM:REP 55->264|PF01571|3.9e-66|52.7|203/211|GCV_T| HM:PFM:REP 278->372|PF08669|8.3e-26|44.1|93/95|GCV_T_C| GO:PFM:NREP 3 GO:PFM GO:0004047|"GO:aminomethyltransferase activity"|PF01571|IPR006222| GO:PFM GO:0005737|"GO:cytoplasm"|PF01571|IPR006222| GO:PFM GO:0006546|"GO:glycine catabolic process"|PF01571|IPR006222| RP:SCP:NREP 2 RP:SCP:REP 10->294|1pj5A4|4e-66|24.3|272/315|d.250.1.1| RP:SCP:REP 296->382|1v5vA1|9e-23|32.1|84/89|b.44.2.1| HM:SCP:REP 8->295|1v5vA2|5.9e-82|49.3|274/0|d.250.1.1|1/1|Folate-binding domain| HM:SCP:REP 285->382|1vloA1|1.9e-27|41.1|95/100|b.44.2.1|1/1|Aminomethyltransferase beta-barrel domain| OP:NHOMO 1358 OP:NHOMOORG 853 OP:PATTERN 111-111111111111--------31113-11----------------------11111111111--- 121111-----11111111-1311211111113222114411111121-11-4532111111411371111-----------61----1111-111---1-211111111--------------11111111111111122---11111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111-11111111111111111111-----------------------------------------------------------------------11--1111111-1--111----1---11----11-1-11111111-1--1-1211111111131221111112111231232223-332333313I2-8443757769AA561113742222A7G1111111121113111-----------------------------71121-112212222223211122362222122332321--11321111111112--112-21111111111111111-2-1111111111-1111111-1111121---------------------------1111-1-1411111111111111111111111--11112------11111111111111111-11-1111111111111111111111111111111111111111111111111-111111111111---111111111111122---------------------1111313333333663433144411111111111111-11111111111111111111111111-111111--------1-1-------------------------1111111111111 22--11--421-11121222111222211111111111111111111111222211111111111-11-111111-111111-11111-13111121111111111-2217232324121123333132EY3-44812114123-1111121143212236314321123211231111K1111121232211221113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 99.0 SQ:SECSTR ###cGGGGccEEcTTHHHHHHTTcEEEEETTEEEEEEcTTcHHHHHHHHHHcEEEEEcTTcEEEEEEcTTHH#TTHHHHHHHHccccTTTccTTcEEEEEEEcTTccEEEEEEEEEEETEEEEEEcGGGHHHHHHHHHHHTTcccEEEEccccEEEEEEcTTHHHHHHHTTcccTTccTTcEEcccTTTETcEEEccccccccEEEEEEcHHHHHHHHHHHHTcTTEEEccHHHHHHHHHHTTccccTTTccTTccTTTTTcGGGccHHHHHHccHHcccTTHHHHHHHHHHccccEEEEEEEcccccccTTcEEEETcTTccEEEEEEEEEEETTTTEEEEEEEEcGGGccTTcEEEEEETTEEEEEEEEccccccccccc DISOP:02AL 1-9,378-383| PSIPRED cccccccccccccccHHHHHHcccEEEEEccEEccHHccHHHHHHHHHHHHccEEEEccccEEEEEEcccccHHHHHHHHHHccccccccccccEEEEEEEEcccccEEEEEEEEEccccEEEEEcccHHHHHHHHHHHHcccccEEEEcccEEEEEEEcccHHHHHHHHcccHHHcccccEEEEEEccEEEEEEEEcccccccEEEEEcHHHHHHHHHHHHHccccEEEcHHHHHHHHHHcccccccccccccccHHHcccHHHcccccccccccccccccHHHHHHHHHccccEEEEEEEEEcccccccccEEEEEccccEEEEEEEEEcccccccccEEEEEEcHHHcccccEEEEEEccEEEEEEEEEccEEcccccc //