[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38978.1
DDBJ      :             transcriptional regulator, Crp/Fnr family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  132/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->226 1zrfA PDBj 1e-09 23.2 %
:RPS:PDB   36->230 1db9A PDBj 9e-27 19.5 %
:RPS:SCOP  36->161 1cx4A2  b.82.3.2 * 4e-18 20.2 %
:RPS:SCOP  191->225 2p8tA1  a.4.5.72 * 2e-04 17.1 %
:HMM:SCOP  34->163 1omiA1 b.82.3.3 * 8.3e-30 32.3 %
:HMM:SCOP  164->233 1hw5A1 a.4.5.4 * 8.1e-10 37.1 %
:RPS:PFM   50->135 PF00027 * cNMP_binding 2e-10 36.0 %
:HMM:PFM   49->136 PF00027 * cNMP_binding 5.1e-22 39.8 88/91  
:HMM:PFM   192->214 PF01381 * HTH_3 0.00012 43.5 23/55  
:BLT:SWISS 35->226 NTCA_SYNE7 2e-11 28.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38978.1 GT:GENE ABE38978.1 GT:PRODUCT transcriptional regulator, Crp/Fnr family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1960038..1960793) GB:FROM 1960038 GB:TO 1960793 GB:DIRECTION - GB:PRODUCT transcriptional regulator, Crp/Fnr family GB:PROTEIN_ID ABE38978.1 GB:DB_XREF GI:91682676 InterPro:IPR000595 InterPro:IPR001808 InterPro:IPR012318 LENGTH 251 SQ:AASEQ MVKFDLCQLIFFWMVPAKTTAIYETGNMTKPFDAIAFLEKVGEGRSISKFKKNDNIFVQGDEASSVFYIQSGAVKLNVVSEQGKEAVIAIIEAGHFLGEACLSGHFVRTATASAMTDTVLTSITKTAMLAALEREPKLAEMFLRHVLARSRRIEEDLIDQLFNSSERRLARTLLLLANFGKPGHPQPISVEISQATLAEMIGTTRSRVSYFMNKFRRLGFISYNGKIHVHSSLLNAVLHEKPGDKNEDDVV GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 35->226|NTCA_SYNE7|2e-11|28.9|190/222| SEG 167->177|rrlartlllla| BL:PDB:NREP 1 BL:PDB:REP 47->226|1zrfA|1e-09|23.2|177/203| RP:PDB:NREP 1 RP:PDB:REP 36->230|1db9A|9e-27|19.5|195/200| RP:PFM:NREP 1 RP:PFM:REP 50->135|PF00027|2e-10|36.0|86/90|cNMP_binding| HM:PFM:NREP 2 HM:PFM:REP 49->136|PF00027|5.1e-22|39.8|88/91|cNMP_binding| HM:PFM:REP 192->214|PF01381|0.00012|43.5|23/55|HTH_3| RP:SCP:NREP 2 RP:SCP:REP 36->161|1cx4A2|4e-18|20.2|124/139|b.82.3.2| RP:SCP:REP 191->225|2p8tA1|2e-04|17.1|35/67|a.4.5.72| HM:SCP:REP 34->163|1omiA1|8.3e-30|32.3|130/0|b.82.3.3|1/1|cAMP-binding domain-like| HM:SCP:REP 164->233|1hw5A1|8.1e-10|37.1|70/71|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 175 OP:NHOMOORG 133 OP:PATTERN -------------------------------------------------------------------- -13-1----------11--------1-----1--------1111-111----111111--11--------1-111-------1--1---------------11-1211-1------------------------1------1-11---1111---1111----1---1--1------------111--11------------1----------------221---------1------------------------------------------------------------------------------------------1--21222222221211----111-1-------1222---3-11-------12----1-------1331--41435-----------------------------------1-------------11-------------11-------------------------------1-2--------------------1---------1--1------22-----------1--1-----------1--1111----11----------1----------22--------------------------------1---------------------------------------------------------------------------------------------------------------------------------------11-----------------------------11-1-111-------------------------------------------------------------------1-------------------------------------- ---------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 90.4 SQ:SECSTR ################HHHHHHHHHHHHTcGccHHcHHHHHHTTcEEEEEcTTcEEEcTTccccEEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEccTTTccccccccEEEEcccEEEEEEEHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcTTcEEETTEEEEEccHHHHHHHHTccHHHHHHHHHHHHHTTcEEETTEEEEEccHHHHHcHHHHH######## DISOP:02AL 1-1,244-250| PSIPRED cccccccHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHHcEEEEEccccEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEEHHHHccccEEEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHcccHHHHHHHHHHHHHcccEEEccEEEEEcHHHHHHHccccccccccccc //