[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38982.1
DDBJ      :             protein of unknown function DUF1476
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->99 PF07345 * DUF1476 1e-21 63.6 %
:HMM:PFM   1->100 PF07345 * DUF1476 1.1e-44 69.0 100/103  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38982.1 GT:GENE ABE38982.1 GT:PRODUCT protein of unknown function DUF1476 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1962959..1963282) GB:FROM 1962959 GB:TO 1963282 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1476 GB:PROTEIN_ID ABE38982.1 GB:DB_XREF GI:91682680 InterPro:IPR009945 LENGTH 107 SQ:AASEQ MTTFDKREEGFERKFALDEEQKFKAEARRDKLLGLWVAEKLGISGDAAAAYAKEVVIADLEEAGDADVVRKVSKDLADKGIAMTEAEIRAKMGEFFAQAVIEVKAGK GT:EXON 1|1-107:0| SEG 47->52|aaaaya| RP:PFM:NREP 1 RP:PFM:REP 1->99|PF07345|1e-21|63.6|99/103|DUF1476| HM:PFM:NREP 1 HM:PFM:REP 1->100|PF07345|1.1e-44|69.0|100/103|DUF1476| OP:NHOMO 59 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----112111111111111111111111--1--1---111-------1---11111111111111111-------------111------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,105-108| PSIPRED cccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccc //