[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38991.1
DDBJ      :             BolA-like protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  172/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.6
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->77 1xs3A PDBj 7e-14 41.9 %
:RPS:SCOP  1->77 1v9jA  d.52.6.1 * 5e-20 25.0 %
:HMM:SCOP  1->77 1v9jA_ d.52.6.1 * 3e-22 42.1 %
:RPS:PFM   10->77 PF01722 * BolA 2e-14 44.1 %
:HMM:PFM   12->77 PF01722 * BolA 4.5e-20 38.5 65/75  
:BLT:SWISS 8->77 Y3122_SYNY3 2e-15 52.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38991.1 GT:GENE ABE38991.1 GT:PRODUCT BolA-like protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1972124..1972360 GB:FROM 1972124 GB:TO 1972360 GB:DIRECTION + GB:PRODUCT BolA-like protein GB:PROTEIN_ID ABE38991.1 GB:DB_XREF GI:91682689 InterPro:IPR002634 LENGTH 78 SQ:AASEQ MPMDARDIEAMIKAAIPDAEVTIRDLAGDGDHYAATVISESFRGKSRVQQHQIVYQSLRGQMGGVLHALALQTGVPEG GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 8->77|Y3122_SYNY3|2e-15|52.2|69/85| BL:PDB:NREP 1 BL:PDB:REP 2->77|1xs3A|7e-14|41.9|74/80| RP:PFM:NREP 1 RP:PFM:REP 10->77|PF01722|2e-14|44.1|68/71|BolA| HM:PFM:NREP 1 HM:PFM:REP 12->77|PF01722|4.5e-20|38.5|65/75|BolA| RP:SCP:NREP 1 RP:SCP:REP 1->77|1v9jA|5e-20|25.0|76/113|d.52.6.1| HM:SCP:REP 1->77|1v9jA_|3e-22|42.1|76/113|d.52.6.1|1/1|BolA-like| OP:NHOMO 180 OP:NHOMOORG 176 OP:PATTERN ---------------------------111-1------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111---1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111221111111111111111111-111111111111111111--1111221111111111111111111111111111111111111-----1----1-1-1111-11111111--------------------------------------------------1-11-1---------1111------------------------------1----------------------------11---------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111------1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 94.9 SQ:SECSTR #ccHHHHHHHHHHHHccccEEEEE##ccTTcccEEEEEcGGGcccccHHHHHHHHHHTTcTTTTcccccEEEEEcGG# DISOP:02AL 1-3,77-79| PSIPRED ccccHHHHHHHHHHHccccEEEEEEccccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEEEcccc //