[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38995.1
DDBJ      :             protein of unknown function DUF323
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  203/915 : Eukaryota  51/199 : Viruses  0/175   --->[See Alignment]
a.213.1d.169.1
:459 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   242->383 1z70X PDBj 2e-15 34.1 %
:RPS:PDB   237->455 2aiiX PDBj 3e-36 26.2 %
:RPS:SCOP  76->197 1rxqA  a.213.1.1 * 2e-08 5.4 %
:RPS:SCOP  238->455 1y1eX1  d.169.1.7 * 1e-35 28.4 %
:HMM:SCOP  236->455 1z70X1 d.169.1.7 * 2e-62 42.6 %
:RPS:PFM   244->453 PF03781 * FGE-sulfatase 3e-11 42.0 %
:HMM:PFM   239->379 PF03781 * FGE-sulfatase 1e-29 37.1 124/251  
:HMM:PFM   380->455 PF03781 * FGE-sulfatase 1.6e-06 25.0 72/251  
:BLT:SWISS 242->383 SUMF1_BOVIN 5e-14 35.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38995.1 GT:GENE ABE38995.1 GT:PRODUCT protein of unknown function DUF323 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1975422..1976801) GB:FROM 1975422 GB:TO 1976801 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF323 GB:PROTEIN_ID ABE38995.1 GB:DB_XREF GI:91682693 InterPro:IPR005532 LENGTH 459 SQ:AASEQ MGRELTQKIRLRPYIAATSAYLGGHWNCFAEAAFSPKPESLVSNMSSAAASVVNSAESGLASRALSARLSEAYRVVRDETERRAAPLSAEDQVVQSMPDASPAKWHRAHTTWFFEQFLLGPHRPGYQVFHPDYAYLFNSYYVSAGPRHTRAARGLLTRPGADDVTAYRRAVDEAMLALFAEADEATLHKLAPLVEVGLNHEQQHQELLLTDILHAFAQNPIPPAYDRAWRLPAADRSGDDWVDLPEGIHAIGHAGESFHFDNEKPAHRALVGPVKLARHLVTNAEWLEFMADGGYRTATLWLMDGFAAAERDGWEAPGHWRQGEDGAWRIMTLGGLQAIDPDAPVCHISYYEADAYARWRGKHLPTEMEWEVAARAGHLNDAFGLVWQWTRSSYSPYPGYRAIEGALGEYNGKFMVNQLVLRGSSCVTPADHSRLTYRNFFYPHHRWQFTGLRLADYDV GT:EXON 1|1-459:0| BL:SWS:NREP 1 BL:SWS:REP 242->383|SUMF1_BOVIN|5e-14|35.6|135/374| SEG 40->72|slvsnmssaaasvvnsaesglasralsarlsea| SEG 200->209|heqqhqelll| BL:PDB:NREP 1 BL:PDB:REP 242->383|1z70X|2e-15|34.1|135/274| RP:PDB:NREP 1 RP:PDB:REP 237->455|2aiiX|3e-36|26.2|214/274| RP:PFM:NREP 1 RP:PFM:REP 244->453|PF03781|3e-11|42.0|188/253|FGE-sulfatase| HM:PFM:NREP 2 HM:PFM:REP 239->379|PF03781|1e-29|37.1|124/251|FGE-sulfatase| HM:PFM:REP 380->455|PF03781|1.6e-06|25.0|72/251|FGE-sulfatase| RP:SCP:NREP 2 RP:SCP:REP 76->197|1rxqA|2e-08|5.4|112/174|a.213.1.1| RP:SCP:REP 238->455|1y1eX1|1e-35|28.4|211/272|d.169.1.7| HM:SCP:REP 236->455|1z70X1|2e-62|42.6|216/0|d.169.1.7|1/1|C-type lectin-like| OP:NHOMO 362 OP:NHOMOORG 256 OP:PATTERN ------------------------------------------------------------------11 11--1--1------11122-21--1222222121111111-111-1--------------311-122121------------1------------------1-212-1---------------------2---3----------2-1-11111----111111111111---1-----1--------------------------------------------1--------1-----------------------------------------------------------1-111-1----------------------------------------------------------------------------21111-----1131111111111------------12121121--1----------211121-1---1112---------------1-2-------------------------------1-22--1--11111121----11111111-11112232-12222211112113-1212------------1-311---2---------------1--1--222211---------------------------------21--11-------------------1---1--1------------1-------------------------------------------------------------------------------1----------11---------------------------11--------1----1--------------1------------1111111111------------11------------------------------------------------- ---------------------------------111-----------------------------------------------------------1-------1---------1-11-211-212113-9I3-314111-3112211--12213-22-2---1-----------1----1111--------11-2---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 246 STR:RPRED 53.6 SQ:SECSTR #################################################################################################################################################################################################################ccccccTTccccccccEcccccccccccTTcEEEEccEEEEEcccccccGGGTccccEEEEEccEEEEcccccHHHHHHHHHHHccccHHHHHcEEEEEGGGccccTTEEEEETccTcTcTTcTTcccTTcTTcccccccHHHHHHHHHHTTcccccHHHHHHHHHTTcccccccccEEEEEEEcccccccccEEccccccccccEcccEEEEcccTTccTTTccTTccEEEcTTcccTTEEcccE#### DISOP:02AL 1-6| PSIPRED ccHHHHHHHcccccccccHHHHccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccccccHHHHccHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccEEEEEcccccccccccccccEEEEEcccHHHcccccHHHHHHHHHHcccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHcccccccccccccccEEEEEcc //