[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39002.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.43.1
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->235 1ciaA PDBj 1e-09 12.5 %
:RPS:SCOP  7->234 1b5sA  c.43.1.1 * 3e-06 25.0 %
:HMM:SCOP  1->236 1eafA_ c.43.1.1 * 3.8e-17 22.5 %
:HMM:PFM   6->72 PF00198 * 2-oxoacid_dh 4.5e-08 29.9 67/231  
:HMM:PFM   207->235 PF00198 * 2-oxoacid_dh 0.00017 34.5 29/231  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39002.1 GT:GENE ABE39002.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1982089..1982871) GB:FROM 1982089 GB:TO 1982871 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39002.1 GB:DB_XREF GI:91682700 LENGTH 260 SQ:AASEQ MRGAIRPISLRRRLIADLMRASEGVPLITYQRTLDLTPLAQARARLPSPPGFAAIIAKAFALVAREQPVLRTLVVDFPWPHFYELPRSVGAIAIAREIDGEDCVLIQKLVAPDELALTGVDALIREAQTSPINEVPMFRKLLRISALPWPLRRIAWWSGLSLARQRANYFGSFGLSSVSAIGPGNLYPTSPGPYILSYGRLGDDGRLDMVIRFDHRLIDAAPIARIMTRLEQVLNTAIAGELQAMHSPSTGHPPVRAVGI GT:EXON 1|1-260:0| SEG 52->61|faaiiakafa| RP:PDB:NREP 1 RP:PDB:REP 1->235|1ciaA|1e-09|12.5|200/213| HM:PFM:NREP 2 HM:PFM:REP 6->72|PF00198|4.5e-08|29.9|67/231|2-oxoacid_dh| HM:PFM:REP 207->235|PF00198|0.00017|34.5|29/231|2-oxoacid_dh| RP:SCP:NREP 1 RP:SCP:REP 7->234|1b5sA|3e-06|25.0|196/242|c.43.1.1| HM:SCP:REP 1->236|1eafA_|3.8e-17|22.5|204/243|c.43.1.1|1/1|CoA-dependent acyltransferases| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111--------------------1---------11--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 235 STR:RPRED 90.4 SQ:SECSTR ccEEEcccTTcTHHHHHHHHHTcHccEEEEEEEEEcHHHHHHHHTccHcccHHHHHHHHHHHHHTTcGGGGEEEETTEEEEEcccEEEEccEEEEETEEETTTTEEEEEEccccccHHHHHHHHHHHHHccHHHHTTcccccTTcccccTcTTccTcccccccTTccEEEcEEEEEEETTcccccccccccccccccEEEEEcTTEEEEEEEEETTTccHHHHHHHHHHHHHHHT######################### DISOP:02AL 1-6| PSIPRED cccccEEcccHHHHHHHHHHHHccccEEEEEEEEcHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHcccHHHEEEEEEEEccEEEEEEEccccHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHcccccEEEEEEEccccccccccccccEEEEEEEccccEEEEEEEEccEEccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEccc //