[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39006.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 12->93 SYQ_KLEP3 7e-04 28.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39006.1 GT:GENE ABE39006.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1986230..1986562 GB:FROM 1986230 GB:TO 1986562 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39006.1 GB:DB_XREF GI:91682704 LENGTH 110 SQ:AASEQ MWRRASPLTPVMRGLDPRIHRARSAPIEVHLAKRMDCRVKPGNDGELLDADVVRMSAATSGIAAGPAYRFAHAGYLLVIDQRAHGATLALPSTHLTRLRLSPALPHCESR GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 12->93|SYQ_KLEP3|7e-04|28.0|82/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,108-111| PSIPRED cccccccccHHHHcccHHHHHHHHHHHHHHHHHHHccEEcccccccEEcccEEEEEcccccccccccHHcccccEEEEEEccccccEEEcccccEEEEEEcccccccccc //